(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE326

ASHGO_5.PE326        Location/Qualifiers
FT   CDS             join(579017..579032,579138..580597)
FT                   /codon_start=1
FT                   /gene_family="HOG000202292" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081289"
FT                   /locus_tag="AGOS_AEL029W"
FT                   /product="AEL029Wp"
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="AAS52656.2"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG027359"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI0001DB28AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q757P1"
FT                   /transl_table=1
FT                   /translation="MGDFEFSIKHAGKVLPIKLPAGSTGADLRKAVEELVQIPADRQKY
FT                   MVKGGLGDETAVADVVKPGSSVLLLGTPDKDMVVKPRTAEKFIEDLGADAQSGQLSRVP
FT                   MGIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKKATAEGMDLYHVQLIREIQATFRK
FT                   LRDKKGEAITPMLLLEILRRVFPQFSEMDRQGGFYKQQDAEELFTQLFHTMQTVFGEEL
FT                   IDRFKIGFKTTIKDTMNEGDVTEKTEDDLKLRCHITGATNFMKAGIKESLKETIEKRSD
FT                   VTGASSTYSVEKKITKLPEYLTVQYVRFFWKKSTGKKSKILRKVQFPFQLDVADLLTPE
FT                   YAQTKIQVREAFREVDKERAESIRERKRSKFNPAPAEGGSTPAEAAEIARSLEESTREK
FT                   WARAFAAKTPADLGRGENPSCVYDLIGVITHQGANSESGHYQAFMRDEFDDDKWYKFND
FT                   DKVTAIEKEKIESLAGGGESDSALILIYKGFGL"
     MGDFEFSIKH AGKVLPIKLP AGSTGADLRK AVEELVQIPA DRQKYMVKGG LGDETAVADV        60
     VKPGSSVLLL GTPDKDMVVK PRTAEKFIED LGADAQSGQL SRVPMGIVNM GNTCYMNATL       120
     QGLYGIVPLR EQILAFDDKK ATAEGMDLYH VQLIREIQAT FRKLRDKKGE AITPMLLLEI       180
     LRRVFPQFSE MDRQGGFYKQ QDAEELFTQL FHTMQTVFGE ELIDRFKIGF KTTIKDTMNE       240
     GDVTEKTEDD LKLRCHITGA TNFMKAGIKE SLKETIEKRS DVTGASSTYS VEKKITKLPE       300
     YLTVQYVRFF WKKSTGKKSK ILRKVQFPFQ LDVADLLTPE YAQTKIQVRE AFREVDKERA       360
     ESIRERKRSK FNPAPAEGGS TPAEAAEIAR SLEESTREKW ARAFAAKTPA DLGRGENPSC       420
     VYDLIGVITH QGANSESGHY QAFMRDEFDD DKWYKFNDDK VTAIEKEKIE SLAGGGESDS       480
     ALILIYKGFG L                                                            491
//

If you have problems or comments...

PBIL Back to PBIL home page