(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE329

ASHGO_5.PE329        Location/Qualifiers
FT   CDS             complement(584558..585607)
FT                   /codon_start=1
FT                   /gene_family="HOG000190358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929981"
FT                   /locus_tag="AGOS_AEL026C"
FT                   /product="AEL026Cp"
FT                   /function="SNAP receptor activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52659.2"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG059023"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniParc:UPI0001DB28CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q757N8"
FT                   /transl_table=1
FT                   /translation="MYRDRTNLFLSYHRTFPHQRHWRSQQGPGAGGEPGDVEAVGEIGA
FT                   AEEAHPMLEMAQKQAAQLPPGFFEEVQRIDAELAGNDVHMVALAKLYRKNALPGFVDKT
FT                   ADEREIEALSFKTIAGLQRCYEAIKRLQAGREAQRFQGRALGRGELAILENCCRAYAAK
FT                   IQAASHRFRVMQNNYLKFLNNDDFKPLPAATNDQETLQLLEEEGEREAQQELDSYSQQT
FT                   LQKQRQKQRETQYLEDRDAEITQLAKGVLEVSTIFREMQTLILDQGTVVDRIDYNLENT
FT                   NIDLKQAQRELDQAVGYQKRTQKCKVIMLLSLLVVFFFFVVLLKPRSSGTPDKGAGARP
FT                   EDRPAEDRN"
     MYRDRTNLFL SYHRTFPHQR HWRSQQGPGA GGEPGDVEAV GEIGAAEEAH PMLEMAQKQA        60
     AQLPPGFFEE VQRIDAELAG NDVHMVALAK LYRKNALPGF VDKTADEREI EALSFKTIAG       120
     LQRCYEAIKR LQAGREAQRF QGRALGRGEL AILENCCRAY AAKIQAASHR FRVMQNNYLK       180
     FLNNDDFKPL PAATNDQETL QLLEEEGERE AQQELDSYSQ QTLQKQRQKQ RETQYLEDRD       240
     AEITQLAKGV LEVSTIFREM QTLILDQGTV VDRIDYNLEN TNIDLKQAQR ELDQAVGYQK       300
     RTQKCKVIML LSLLVVFFFF VVLLKPRSSG TPDKGAGARP EDRPAEDRN                   349
//

If you have problems or comments...

PBIL Back to PBIL home page