(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE337

ASHGO_5.PE337        Location/Qualifiers
FT   CDS             complement(601134..602285)
FT                   /codon_start=1
FT                   /gene_family="HOG000074712" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624456"
FT                   /locus_tag="AEL018C"
FT                   /orf_name="AGOS_AEL018C"
FT                   /product="AEL018Cp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52667.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059026"
FT                   /db_xref="InterPro:IPR013952"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000252D56"
FT                   /db_xref="UniProtKB/TrEMBL:Q757L8"
FT                   /transl_table=1
FT                   /translation="MAERWINACFEAYDTTIRHAEDVGAQAVQSARAVYNVACETVSEI
FT                   ARRAGTEERGVAVLAEKPAGGVAAAREHILAAVVGLAGRPRVRAAAAAAAAGLLVYVAG
FT                   RALVPAVAARVVGERETVLVLGEMTDPITRALVYDLHRRGFCVFVCSTSEKRDRQLEDE
FT                   YEKVPSPWDQEGGVCHMAATPEAVARLTEFLQREERRLRGVLVVPSSCFFTSGMFTNIP
FT                   EGQVRSELQENLVNTWAVVTRLLPQFDSASRDKLQVVVFNPSLSQKLNLQYHSLELLMS
FT                   STMESLYRILANECGYLADVYQCHLGILNIAGNASNYKYLTINGSHITKALCEPIYELL
FT                   LSRDNMWVRFKRWLQGPVLYCGKGSRLACWLRSYAPLWLLEFI"
     MAERWINACF EAYDTTIRHA EDVGAQAVQS ARAVYNVACE TVSEIARRAG TEERGVAVLA        60
     EKPAGGVAAA REHILAAVVG LAGRPRVRAA AAAAAAGLLV YVAGRALVPA VAARVVGERE       120
     TVLVLGEMTD PITRALVYDL HRRGFCVFVC STSEKRDRQL EDEYEKVPSP WDQEGGVCHM       180
     AATPEAVARL TEFLQREERR LRGVLVVPSS CFFTSGMFTN IPEGQVRSEL QENLVNTWAV       240
     VTRLLPQFDS ASRDKLQVVV FNPSLSQKLN LQYHSLELLM SSTMESLYRI LANECGYLAD       300
     VYQCHLGILN IAGNASNYKY LTINGSHITK ALCEPIYELL LSRDNMWVRF KRWLQGPVLY       360
     CGKGSRLACW LRSYAPLWLL EFI                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page