(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE342

ASHGO_5.PE342        Location/Qualifiers
FT   CDS             complement(610209..611888)
FT                   /codon_start=1
FT                   /gene_family="HOG000191845" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081291"
FT                   /gene_name="SIR2"
FT                   /locus_tag="AEL013C"
FT                   /product="NAD-dependent histone deacetylase SIR2 "
FT                   /EC_number="3.5.1.-"
FT                   /function="NAD binding"
FT                   /function="NAD-dependent histone deacetylase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52672.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017136"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG191410"
FT                   /db_xref="HOGENOM:HBG203103"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR007654"
FT                   /db_xref="UniParc:UPI0000252D5B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757M7"
FT                   /transl_table=1
FT                   /translation="MSESASMLQGSKRGTDSSVDVGGAKRTKVDMDDGSSSNNDEKELL
FT                   EATKADELDEVVDDYAEQNDHSAQEVAGEYVPKKPEQPIMLTKDSNSGKYVFPPISKED
FT                   SLNARYFLKYHGSAQFLDSYLPEDLNSLYVFHLIKLLGFQLKDRELLTAVQKAVQNDVT
FT                   SGVSSVVGTNPMVERVSPPQLSASTPSGDGYDDPLEKKHAVRLIKDLQKAMNKVLSTRI
FT                   RLANFFTLDHFISKLKSAKKVLVLTGAGISTSLGIPDFRSSKGFYSQVTNLGLDDPQDV
FT                   FNLDIFMENPSVFYTIAEKILPPEHKFSPLHSFIKMIQDKGKLLRNYTQNIDNLESYAG
FT                   IFKENIVQCHGSFATASCVTCHLKMPGERIFQQIKDREIPLCAYCYPKRQEEYPTVSDD
FT                   PGTKNGQQSSHNSSSIFHMSRSFGVIKPDITFFGEALPLEFHTNIRQDVLQCDLLICIG
FT                   TSLKVAPVSEIVNMVPAHVPQVLINRDPVKHAEFDLTLLGLCDDVAAFIAQKCGWDIPH
FT                   ENWPQLKQRNIQYDELERGMYYVYDPVKEQAKDTGQRQVQAP"
     MSESASMLQG SKRGTDSSVD VGGAKRTKVD MDDGSSSNND EKELLEATKA DELDEVVDDY        60
     AEQNDHSAQE VAGEYVPKKP EQPIMLTKDS NSGKYVFPPI SKEDSLNARY FLKYHGSAQF       120
     LDSYLPEDLN SLYVFHLIKL LGFQLKDREL LTAVQKAVQN DVTSGVSSVV GTNPMVERVS       180
     PPQLSASTPS GDGYDDPLEK KHAVRLIKDL QKAMNKVLST RIRLANFFTL DHFISKLKSA       240
     KKVLVLTGAG ISTSLGIPDF RSSKGFYSQV TNLGLDDPQD VFNLDIFMEN PSVFYTIAEK       300
     ILPPEHKFSP LHSFIKMIQD KGKLLRNYTQ NIDNLESYAG IFKENIVQCH GSFATASCVT       360
     CHLKMPGERI FQQIKDREIP LCAYCYPKRQ EEYPTVSDDP GTKNGQQSSH NSSSIFHMSR       420
     SFGVIKPDIT FFGEALPLEF HTNIRQDVLQ CDLLICIGTS LKVAPVSEIV NMVPAHVPQV       480
     LINRDPVKHA EFDLTLLGLC DDVAAFIAQK CGWDIPHENW PQLKQRNIQY DELERGMYYV       540
     YDPVKEQAKD TGQRQVQAP                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page