(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE344

ASHGO_5.PE344        Location/Qualifiers
FT   CDS             612964..614277
FT                   /codon_start=1
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758014"
FT                   /locus_tag="AEL011W"
FT                   /orf_name="AGOS_AEL011W"
FT                   /product="AEL011Wp"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS52674.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI0000252D5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M5"
FT                   /transl_table=1
FT                   /translation="MGQGASTYGKGQKGKKDKKQKPKYEPPVQSKIGRKKRKGPATAEK
FT                   LPNVYPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEMKQEEERKQLEEIRGTPL
FT                   SIGTLEEIIDDDHAIVTSPTTPDFYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDD
FT                   ADPMVSVMKIDKSPTESYNDIGGLEAQIQEIKEAVELPLTHPELYEEMGIKPPKGVILY
FT                   GAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVFI
FT                   DEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPALIR
FT                   PGRIDRKILFENPDVSTKRKILGIHTSKMNLSADVDLETLVTSKDDLSGADIKAMCTEA
FT                   GLLALRERRMQVTVEDFKQAKERVMKNKVEENLEGLYL"
     MGQGASTYGK GQKGKKDKKQ KPKYEPPVQS KIGRKKRKGP ATAEKLPNVY PSTRCKLKLL        60
     RMERIKDHLL LEEEFVTNSE ILKPFEMKQE EERKQLEEIR GTPLSIGTLE EIIDDDHAIV       120
     TSPTTPDFYV SILSFVDKEL LEPGCSVLLH HKTMSIVGVL QDDADPMVSV MKIDKSPTES       180
     YNDIGGLEAQ IQEIKEAVEL PLTHPELYEE MGIKPPKGVI LYGAPGTGKT LLAKAVANQT       240
     SATFLRIVGS ELIQKYLGDG PRLCRQIFKV AAENAPSIVF IDEIDAIGTK RYDSNSGGER       300
     EIQRTMLELL NQLDGFDDRG DVKVIMATNK IESLDPALIR PGRIDRKILF ENPDVSTKRK       360
     ILGIHTSKMN LSADVDLETL VTSKDDLSGA DIKAMCTEAG LLALRERRMQ VTVEDFKQAK       420
     ERVMKNKVEE NLEGLYL                                                      437
//

If you have problems or comments...

PBIL Back to PBIL home page