(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE345

ASHGO_5.PE345        Location/Qualifiers
FT   CDS             614734..615753
FT                   /codon_start=1
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758015"
FT                   /locus_tag="AGOS_AEL010W"
FT                   /product="AEL010Wp"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="AAS52675.2"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI0001DB28D5"
FT                   /db_xref="UniProtKB/TrEMBL:Q757M1"
FT                   /transl_table=1
FT                   /translation="MGYNETEPAIDGDNNEQRINEDMSTLEHTSNNNGNGLEPVEAGPD
FT                   SGIPAVEGGGSVSGQSPQHEPPAYELSYVVGVAENKNAKFRRTMEDVHTYVENFASRLD
FT                   WGYFAIFDGHAGNQASKWCGSHLHTIIEERILQGDDRDVRDILNDSFVYVDQQINSTLE
FT                   GNSGCTAAVGILRWEAPTPIPNMPINLEQHKRMLYTANVGDTRIILFRNGRSVRLTYDH
FT                   KASDIIEMQRVEKAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGNPFTTSVEITTSDQF
FT                   LIIACDGLWDVVDDQEACEMIKDIEDANEAAKTLVRHALEHGTTDNVTVMVVFFDNNQ"
     MGYNETEPAI DGDNNEQRIN EDMSTLEHTS NNNGNGLEPV EAGPDSGIPA VEGGGSVSGQ        60
     SPQHEPPAYE LSYVVGVAEN KNAKFRRTME DVHTYVENFA SRLDWGYFAI FDGHAGNQAS       120
     KWCGSHLHTI IEERILQGDD RDVRDILNDS FVYVDQQINS TLEGNSGCTA AVGILRWEAP       180
     TPIPNMPINL EQHKRMLYTA NVGDTRIILF RNGRSVRLTY DHKASDIIEM QRVEKAGGLI       240
     MKSRVNGMLA VTRSLGDKFF DSLVVGNPFT TSVEITTSDQ FLIIACDGLW DVVDDQEACE       300
     MIKDIEDANE AAKTLVRHAL EHGTTDNVTV MVVFFDNNQ                              339
//

If you have problems or comments...

PBIL Back to PBIL home page