(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE347

ASHGO_5.PE347        Location/Qualifiers
FT   CDS             617521..617997
FT                   /codon_start=1
FT                   /gene_family="HOG000216023" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758016"
FT                   /gene_name="ATP16"
FT                   /locus_tag="AEL008W"
FT                   /product="ATP synthase subunit delta, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="AAS52677.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG343819"
FT                   /db_xref="HOGENOM:HBG663981"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="UniParc:UPI0000252D60"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757N0"
FT                   /transl_table=1
FT                   /translation="MFRLTSARALFRVANVAARRTYAEAAADALKLNFALPHETLFAGT
FT                   AVKQVNLPVKTGQIGILANHVPIVEQLVPGVVEVLEGSESKKFFVSGGFATVQPDSTLS
FT                   ITSVEAFPLDSFSAENVRALLAEAQKNAGAADSRVAAEASIQIEVLEALQAALK"
     MFRLTSARAL FRVANVAARR TYAEAAADAL KLNFALPHET LFAGTAVKQV NLPVKTGQIG        60
     ILANHVPIVE QLVPGVVEVL EGSESKKFFV SGGFATVQPD STLSITSVEA FPLDSFSAEN       120
     VRALLAEAQK NAGAADSRVA AEASIQIEVL EALQAALK                               158
//

If you have problems or comments...

PBIL Back to PBIL home page