(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE371

ASHGO_5.PE371        Location/Qualifiers
FT   CDS             complement(659326..659976)
FT                   /codon_start=1
FT                   /gene_family="HOG000208731" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624459"
FT                   /locus_tag="AGOS_AER017C"
FT                   /product="AER017Cp"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="AAS52701.2"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG429920"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI0001DB28F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q757J6"
FT                   /transl_table=1
FT                   /translation="MLPKSNSKFISRRGMRMLLVTGVLLVLTYFIIQNGTTSDQFVTPI
FT                   APRPVPNAPSVQDTVEAEEPSVQLLSKGAEGAVAASKEDVDVARAQQQSKVLFDAAKTY
FT                   NEILSLSSMVVFSKSTCPLSSGLKQLLNNNYEFLPDYQVVELDKHANGAELQKYVTKTT
FT                   ARSTVPNLVINGVSRGGHDSIMELHKTGELLESLRKWANGKITVTQKQRPSNS"
     MLPKSNSKFI SRRGMRMLLV TGVLLVLTYF IIQNGTTSDQ FVTPIAPRPV PNAPSVQDTV        60
     EAEEPSVQLL SKGAEGAVAA SKEDVDVARA QQQSKVLFDA AKTYNEILSL SSMVVFSKST       120
     CPLSSGLKQL LNNNYEFLPD YQVVELDKHA NGAELQKYVT KTTARSTVPN LVINGVSRGG       180
     HDSIMELHKT GELLESLRKW ANGKITVTQK QRPSNS                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page