(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE391

ASHGO_5.PE391        Location/Qualifiers
FT   CDS             702063..702710
FT                   /codon_start=1
FT                   /gene_family="HOG000205213" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758044"
FT                   /gene_name="RPB5"
FT                   /locus_tag="AER036W"
FT                   /product="DNA-directed RNA polymerases I, II, and III
FT                   subunit RPABC1"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52720.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG051063"
FT                   /db_xref="HOGENOM:HBG314635"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR005571"
FT                   /db_xref="InterPro:IPR014381"
FT                   /db_xref="InterPro:IPR020608"
FT                   /db_xref="UniParc:UPI0000252D88"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757H7"
FT                   /transl_table=1
FT                   /translation="MDQDNERNVSRLWRAFRTVKEMVRDRGYFITQEEVDLSLEDFKAK
FT                   YCDSMGRPQRKMMSFQSNPTEETLKKSPNMGSVWVEFCDEPSVGIKTMKNFVIHIGEKN
FT                   FQTGIFIYQNGITPSALKLLPSVAPATIETFNETALVVNITHHELVPKHIKLSDEEKKE
FT                   LLKRYRLKESQLPRIQRMDPVALYLGLKRGEVVKIIRKSETSGRYASYRICL"
     MDQDNERNVS RLWRAFRTVK EMVRDRGYFI TQEEVDLSLE DFKAKYCDSM GRPQRKMMSF        60
     QSNPTEETLK KSPNMGSVWV EFCDEPSVGI KTMKNFVIHI GEKNFQTGIF IYQNGITPSA       120
     LKLLPSVAPA TIETFNETAL VVNITHHELV PKHIKLSDEE KKELLKRYRL KESQLPRIQR       180
     MDPVALYLGL KRGEVVKIIR KSETSGRYAS YRICL                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page