(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE396

ASHGO_5.PE396        Location/Qualifiers
FT   CDS             707007..708317
FT                   /codon_start=1
FT                   /gene_family="HOG000181587" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758046"
FT                   /gene_name="CSR1"
FT                   /locus_tag="AER041W"
FT                   /product="Phosphatidylinositol transfer protein CSR1 "
FT                   /biological_process="lipid transport"
FT                   /biological_process="phospholipid catabolic process "
FT                   /cellular_component="endosome"
FT                   /protein_id="AAS52725.2"
FT                   /db_xref="GO:0005768"
FT                   /db_xref="GO:0006869"
FT                   /db_xref="GO:0009395"
FT                   /db_xref="HOGENOM:HBG324518"
FT                   /db_xref="HOGENOM:HBG540797"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI0001DB291A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757H2"
FT                   /transl_table=1
FT                   /translation="MTQTAAPGRVQTLTKEQEKVLKQVWVHLFQFWGIDVDGSAVLTAK
FT                   EPEPAAPSGKGRKLLGLFGKRKDATGAARKESNGKAAAKVYDAEKVEDSDAEKEKPTPQ
FT                   KVEGLEEMYELLKELDGAAVSKEFWSMLRCDYPDNLLLRFVRARKWDINKAMIMMAHSL
FT                   RWRLNEGKPEDIVFGGERGAQKADKKGIVKQLELGKATVRGFDKNGCPIVYVRPRLHHA
FT                   ADQTEAETSEYSLLIIEQARLFLKEPCDTATILFDLSGFSMANMDYAPVKFLITCFEAH
FT                   YPECLGKLFIHKAPWIFPPIWNIIKNWLDPVVAAKIAFTKTAADLEEFIPAEQIPLELG
FT                   GKDEYNFDGFVMPDGSADTKLSDEKGKAAVLEEREAIIKRFIDATISWIESTSDEESAK
FT                   WLEKKIDLSKELSENYSKLDPYIRSRSFYDVNGTLKV"
     MTQTAAPGRV QTLTKEQEKV LKQVWVHLFQ FWGIDVDGSA VLTAKEPEPA APSGKGRKLL        60
     GLFGKRKDAT GAARKESNGK AAAKVYDAEK VEDSDAEKEK PTPQKVEGLE EMYELLKELD       120
     GAAVSKEFWS MLRCDYPDNL LLRFVRARKW DINKAMIMMA HSLRWRLNEG KPEDIVFGGE       180
     RGAQKADKKG IVKQLELGKA TVRGFDKNGC PIVYVRPRLH HAADQTEAET SEYSLLIIEQ       240
     ARLFLKEPCD TATILFDLSG FSMANMDYAP VKFLITCFEA HYPECLGKLF IHKAPWIFPP       300
     IWNIIKNWLD PVVAAKIAFT KTAADLEEFI PAEQIPLELG GKDEYNFDGF VMPDGSADTK       360
     LSDEKGKAAV LEEREAIIKR FIDATISWIE STSDEESAKW LEKKIDLSKE LSENYSKLDP       420
     YIRSRSFYDV NGTLKV                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page