(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE403

ASHGO_5.PE403        Location/Qualifiers
FT   CDS             complement(726236..726619)
FT                   /codon_start=1
FT                   /gene_family="HOG000154459" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758052"
FT                   /gene_name="SWC7"
FT                   /locus_tag="AER048C"
FT                   /product="SWR1-complex protein 7 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52732.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124840"
FT                   /db_xref="InterPro:IPR020195"
FT                   /db_xref="UniParc:UPI0000252D94"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757G5"
FT                   /transl_table=1
FT                   /translation="MEYKYNVTLLLLQVVLHRQQELAHQDKTLSQISLLREPVVDTAVL
FT                   ERFSAHRVVRLYAPELCGLRLEELQAVVREVFARGLAGSAEDTPVTLITLANHYYRLRV
FT                   QELELQELPKLKELMESAAGLRT"
     MEYKYNVTLL LLQVVLHRQQ ELAHQDKTLS QISLLREPVV DTAVLERFSA HRVVRLYAPE        60
     LCGLRLEELQ AVVREVFARG LAGSAEDTPV TLITLANHYY RLRVQELELQ ELPKLKELME       120
     SAAGLRT                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page