(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE407

ASHGO_5.PE407        Location/Qualifiers
FT   CDS             733815..733985
FT                   /codon_start=1
FT                   /gene_family="HOG000231300" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624461"
FT                   /gene_name="RPS29"
FT                   /locus_tag="AER052W"
FT                   /product="40S ribosomal protein S29 "
FT                   /function="metal ion binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="AAS52736.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG312140"
FT                   /db_xref="HOGENOM:HBG589144"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="UniParc:UPI0000252D98"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757G1"
FT                   /transl_table=1
FT                   /translation="MAHENVWFSHPRNYGKGSRQCRVCASHSGLIRKYGLNICRQCFRE
FT                   KANDIGFHKYR"
     MAHENVWFSH PRNYGKGSRQ CRVCASHSGL IRKYGLNICR QCFREKANDI GFHKYR            56
//

If you have problems or comments...

PBIL Back to PBIL home page