(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE41

ASHGO_5.PE41         Location/Qualifiers
FT   CDS             complement(69382..71388)
FT                   /codon_start=1
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19776429"
FT                   /locus_tag="AEL305C"
FT                   /orf_name="AGOS_AEL305C"
FT                   /product="AEL305Cp"
FT                   /function="acetolactate synthase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="AAS52379.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG323037"
FT                   /db_xref="HOGENOM:HBG460149"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="UniParc:UPI0000252C3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q8"
FT                   /transl_table=1
FT                   /translation="MLRRVTVRQLANVRALARATRPLAVARAFSGAAGRLGAEAQEAPR
FT                   RRAPGPRGETEPQGAAGAHEMDHSMIGFSGGEIFHEMMRRHNVDTVFGYPGGAILPVYD
FT                   AIYNSDAFNFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGV
FT                   PMVVFTGQVPKAAIGTDAFQEADVVGISRSCTKWNVMVNHVEELPRRINEAFEIATSGR
FT                   PGPVLVDLPKDVTAAILRSPIPLASALPSTTLAQLTRQAADIDGVRSLADASRLINMAQ
FT                   KPVLYVGAGILNSTRGPEFLRELAEKAQIPVTTTLQALGAFDQEDSKSVDMLGMHGSAA
FT                   ANLTVQNADLIIALGARFDDRVTGNIAKFAPEAQRAAREQRGGIVHFEISPKNINKVVD
FT                   AQVAVEGDVTANLEKLLPLIKPVAERKEWLGQIASWKSEYPYDYSRETPGSRIKPQTVI
FT                   TRLSEIANATGKEVIVTTGVGQHQMWAAQHWTWKKPRTFITSGGLGTMGFGLPAAIGAQ
FT                   VAKPDAIVIDIDGDASLNMTLMEMSSAVQAGAPVKILLLNNEEQGMVTQWQSLFYEHRY
FT                   SHTHQLNPDFVKLADAMGFKAMRLEAQSDMEPMLQEFINCKEPVLLEVAVEKKVPVLPM
FT                   VPAGKALHEFIYFDPEVERQQAELRSRRTGGKH"
     MLRRVTVRQL ANVRALARAT RPLAVARAFS GAAGRLGAEA QEAPRRRAPG PRGETEPQGA        60
     AGAHEMDHSM IGFSGGEIFH EMMRRHNVDT VFGYPGGAIL PVYDAIYNSD AFNFVLPKHE       120
     QGAGHMAEGY ARASGKPGVV LVTSGPGATN VVTPMADALA DGVPMVVFTG QVPKAAIGTD       180
     AFQEADVVGI SRSCTKWNVM VNHVEELPRR INEAFEIATS GRPGPVLVDL PKDVTAAILR       240
     SPIPLASALP STTLAQLTRQ AADIDGVRSL ADASRLINMA QKPVLYVGAG ILNSTRGPEF       300
     LRELAEKAQI PVTTTLQALG AFDQEDSKSV DMLGMHGSAA ANLTVQNADL IIALGARFDD       360
     RVTGNIAKFA PEAQRAAREQ RGGIVHFEIS PKNINKVVDA QVAVEGDVTA NLEKLLPLIK       420
     PVAERKEWLG QIASWKSEYP YDYSRETPGS RIKPQTVITR LSEIANATGK EVIVTTGVGQ       480
     HQMWAAQHWT WKKPRTFITS GGLGTMGFGL PAAIGAQVAK PDAIVIDIDG DASLNMTLME       540
     MSSAVQAGAP VKILLLNNEE QGMVTQWQSL FYEHRYSHTH QLNPDFVKLA DAMGFKAMRL       600
     EAQSDMEPML QEFINCKEPV LLEVAVEKKV PVLPMVPAGK ALHEFIYFDP EVERQQAELR       660
     SRRTGGKH                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page