(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE411

ASHGO_5.PE411        Location/Qualifiers
FT   CDS             join(complement(740906..740943),complement(740412..740847))
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15758057"
FT                   /locus_tag="AER056C"
FT                   /orf_name="AGOS_AER056C"
FT                   /product="AER056Cp"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="AAS52740.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="HSSP:1A3S"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI0000252D9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q757F7"
FT                   /transl_table=1
FT                   /translation="MNSLCLQRLQEERKKWRKDHPFGFWAKPTKKEDGSMNLQKWEAGI
FT                   PGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAGFYHPNIYPSGTVCLSILNEDQDWK
FT                   PAITMKQILLGVQDLLTSPNPNSPAQEPAWRAYAKNLQEYEKKVLEQARRYAK"
     MNSLCLQRLQ EERKKWRKDH PFGFWAKPTK KEDGSMNLQK WEAGIPGREG TIWKDGVYPI        60
     TIEYPDDYPS KPPRVKFPAG FYHPNIYPSG TVCLSILNED QDWKPAITMK QILLGVQDLL       120
     TSPNPNSPAQ EPAWRAYAKN LQEYEKKVLE QARRYAK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page