(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE415

ASHGO_5.PE415        Location/Qualifiers
FT   CDS             747947..748765
FT                   /codon_start=1
FT                   /gene_family="HOG000001141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15759127"
FT                   /gene_name="ATP10"
FT                   /locus_tag="AER060W"
FT                   /product="Mitochondrial ATPase complex subunit ATP10 "
FT                   /biological_process="mitochondrial proton-transporting ATP
FT                   synthase complex assembly"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS52744.2"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0033615"
FT                   /db_xref="HOGENOM:HBG059061"
FT                   /db_xref="HOGENOM:HBG202573"
FT                   /db_xref="InterPro:IPR007849"
FT                   /db_xref="UniParc:UPI0001DB293A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q757F3"
FT                   /transl_table=1
FT                   /translation="MVIWRRYLSGTAQPLVFKKMNKALAQAAPREHVVRRLEQPVGMPQ
FT                   PPTAATRYVEGNSMLDMFSEEKTSRRAAELAAEFSKSGLYDAATFRKTNGRVFLPPASY
FT                   WRAEHARYFPHLGGRTLTGARGSVEDVLAGKVSVVKVFSCETGEGLASSYFRHEGHDYL
FT                   REDDVAPAQIVEISLTESWIKDWLVRLMAGRLRSLVPAARHERYFICRRAQLPFTVRES
FT                   LELGNLYTGYVLVVDPQLKIRWMACGGAEKRDAELLWKCVRGVQRECAAV"
     MVIWRRYLSG TAQPLVFKKM NKALAQAAPR EHVVRRLEQP VGMPQPPTAA TRYVEGNSML        60
     DMFSEEKTSR RAAELAAEFS KSGLYDAATF RKTNGRVFLP PASYWRAEHA RYFPHLGGRT       120
     LTGARGSVED VLAGKVSVVK VFSCETGEGL ASSYFRHEGH DYLREDDVAP AQIVEISLTE       180
     SWIKDWLVRL MAGRLRSLVP AARHERYFIC RRAQLPFTVR ESLELGNLYT GYVLVVDPQL       240
     KIRWMACGGA EKRDAELLWK CVRGVQRECA AV                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page