(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE424

ASHGO_5.PE424        Location/Qualifiers
FT   CDS             763090..763596
FT                   /codon_start=1
FT                   /gene_family="HOG000204790" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI19777279"
FT                   /locus_tag="AER069W"
FT                   /orf_name="AGOS_AER069W"
FT                   /product="AER069Wp"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="AAS52753.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG489199"
FT                   /db_xref="HOGENOM:HBG717354"
FT                   /db_xref="InterPro:IPR008417"
FT                   /db_xref="UniParc:UPI0000252DA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q757E4"
FT                   /transl_table=1
FT                   /translation="MSLYYSLVFAMLVCESAVFALLAVPLPMAVRRPLTRALARPFESA
FT                   TVQMVLKVLLGFVLLLFVDTTNRLYVVNREYERARHVEFAHGRRELLSRKFLAQRNMYL
FT                   TGITLFLTFMLGQTFNLVLELLALKGATERPGATTAAGLRAEIEECEKELARLKAQADA
FT                   LAEDM"
     MSLYYSLVFA MLVCESAVFA LLAVPLPMAV RRPLTRALAR PFESATVQMV LKVLLGFVLL        60
     LFVDTTNRLY VVNREYERAR HVEFAHGRRE LLSRKFLAQR NMYLTGITLF LTFMLGQTFN       120
     LVLELLALKG ATERPGATTA AGLRAEIEEC EKELARLKAQ ADALAEDM                    168
//

If you have problems or comments...

PBIL Back to PBIL home page