(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE436

ASHGO_5.PE436        Location/Qualifiers
FT   CDS             complement(784487..787558)
FT                   /codon_start=1
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15759138"
FT                   /locus_tag="AGOS_AER081C"
FT                   /product="AER081Cp"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="AAS52765.2"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG053553"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI0001DB295B"
FT                   /db_xref="UniProtKB/TrEMBL:Q757D2"
FT                   /transl_table=1
FT                   /translation="MEKSWYPTRELAAASPNHQQQCSKSVAYRQRSCVVKAGRVVVSFC
FT                   LMKLVFRDLKNLYGHRARCTSLTNSQAYSSRLRSARPLLINMAESDVAKRQRTGKNVSG
FT                   QAAHASRIFSPFRVVGNVTNETPFAVGTLGTTFYIATSVGKSFQIYDASNLHLLFVSAQ
FT                   QTSSPITCLATHHHYLYAGFGKHVGIYKRGQLERLLTLPDCNATVRHMCVFGGYLCVSA
FT                   DDNSVYVFKTEGGSKYPTEFYTKFNIGSLLGGEILELVHLPTYLNKLVVVTHSNIVLYN
FT                   IRTRKMLFSSDEFPDRITAAECAPALDVLALGTITGEVVLYNMKKGRKIRSIQTTNRVS
FT                   SLSFRTDGSAHMAIASTNGDLVFYDLNRKTRIHVLKGIHRDTYGGISKVSFLNGQSIVV
FT                   TSGGDNQLKEFAFDPSLSQSESETVVQPPRLLRSRGGHSQPPSRICFADSHSHFLMSAS
FT                   KDRSLWGFSLRKDAQSQEFSQRLHKNKDGSRIGGSTMKEKFPEIIALAIENFREGDWEN
FT                   VVTAHNGERAARTWNTKTKRVGRWTLSTSDDGLVKSVAMTQCGNFALIGSSNGGISVYN
FT                   LQSGIKRKVYKMHKGSVTGLAVDGMNRKMVSCGLDGLVGFYDFTTNSFLGKLQLGAPIT
FT                   QLVYHRASELFAVALDDFSIQVIDSVTQRVVRQLWGHSNRITAFDFSPDGRWIVSASLD
FT                   STLRTWDLPTGTCIDGVRLESVATNVQFSANGDILATTHVAGNGIAIWSNRSQFKAIST
FT                   RQIDEEAFARLLLPSASEDGGVSMLEGAFDAEDEEQSMGTYKSLEQINESLITLSLGPR
FT                   NKMNTLLKLDVIRQRSKPKEAPKKPEKAPFFLQLTGEKVGDDASGREDALNANATTSLK
FT                   EQEEKAASMQVQDQLAKFKPTTKLGFESEFTKLLRTSAAESDYNNFLVHLVNMSPASID
FT                   LEIRSLNAFEPFEEIVWFIEALVEGLKSGKNFDLYEAFMSLLFKAHGDIINANNKHEGI
FT                   ARSLQEWRAIHNSREHLDDLVKFCSSIINFVTTT"
     MEKSWYPTRE LAAASPNHQQ QCSKSVAYRQ RSCVVKAGRV VVSFCLMKLV FRDLKNLYGH        60
     RARCTSLTNS QAYSSRLRSA RPLLINMAES DVAKRQRTGK NVSGQAAHAS RIFSPFRVVG       120
     NVTNETPFAV GTLGTTFYIA TSVGKSFQIY DASNLHLLFV SAQQTSSPIT CLATHHHYLY       180
     AGFGKHVGIY KRGQLERLLT LPDCNATVRH MCVFGGYLCV SADDNSVYVF KTEGGSKYPT       240
     EFYTKFNIGS LLGGEILELV HLPTYLNKLV VVTHSNIVLY NIRTRKMLFS SDEFPDRITA       300
     AECAPALDVL ALGTITGEVV LYNMKKGRKI RSIQTTNRVS SLSFRTDGSA HMAIASTNGD       360
     LVFYDLNRKT RIHVLKGIHR DTYGGISKVS FLNGQSIVVT SGGDNQLKEF AFDPSLSQSE       420
     SETVVQPPRL LRSRGGHSQP PSRICFADSH SHFLMSASKD RSLWGFSLRK DAQSQEFSQR       480
     LHKNKDGSRI GGSTMKEKFP EIIALAIENF REGDWENVVT AHNGERAART WNTKTKRVGR       540
     WTLSTSDDGL VKSVAMTQCG NFALIGSSNG GISVYNLQSG IKRKVYKMHK GSVTGLAVDG       600
     MNRKMVSCGL DGLVGFYDFT TNSFLGKLQL GAPITQLVYH RASELFAVAL DDFSIQVIDS       660
     VTQRVVRQLW GHSNRITAFD FSPDGRWIVS ASLDSTLRTW DLPTGTCIDG VRLESVATNV       720
     QFSANGDILA TTHVAGNGIA IWSNRSQFKA ISTRQIDEEA FARLLLPSAS EDGGVSMLEG       780
     AFDAEDEEQS MGTYKSLEQI NESLITLSLG PRNKMNTLLK LDVIRQRSKP KEAPKKPEKA       840
     PFFLQLTGEK VGDDASGRED ALNANATTSL KEQEEKAASM QVQDQLAKFK PTTKLGFESE       900
     FTKLLRTSAA ESDYNNFLVH LVNMSPASID LEIRSLNAFE PFEEIVWFIE ALVEGLKSGK       960
     NFDLYEAFMS LLFKAHGDII NANNKHEGIA RSLQEWRAIH NSREHLDDLV KFCSSIINFV      1020
     TTT                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page