(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE442

ASHGO_5.PE442        Location/Qualifiers
FT   CDS             complement(801766..803118)
FT                   /codon_start=1
FT                   /gene_family="HOG000274133" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081545"
FT                   /locus_tag="AGOS_AER087C"
FT                   /product="AER087Cp"
FT                   /function="catalytic activity"
FT                   /biological_process="polyamine biosynthetic process "
FT                   /protein_id="AAS52771.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006596"
FT                   /db_xref="HOGENOM:HBG152288"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="UniParc:UPI0001DB2979"
FT                   /db_xref="UniProtKB/TrEMBL:Q757C6"
FT                   /transl_table=1
FT                   /translation="MIAKEIAPALAQDQPEEVKHDSLCQARDHVTTGLAGLVATDPTTQ
FT                   KTGAHEQAHQAVFQAMKEHVERVNKDTCDAGEENSFFVCDLGEVERLLRYWRRELPRVQ
FT                   PYYAVKCNPDVRVLERLASLGVNFDCASKAEIERVLQLGVAPERIIYANPCKVSSFIRF
FT                   AAARGVRQSTFDNVEELYKIARFHPESQLLLRISTDDSTAQCQLSAKYGCSPDEVDPLL
FT                   AKVAELGLNLVGVSFHIGSGASDFSSLTQAVVDARRVFDRAAHFGLPALRVLDVGGGFQ
FT                   FDTFHQSSAILNAALDTHFPPGSGVELIAEPGRFLVATAFTLSSHVIAKRELPERGSML
FT                   YINDGIYANMNCILFDHYQPTPRVLYHAAAFHYFDTTSSKSRTAACPHRTSIWGPTCDG
FT                   LDCITDEYYLRYDLAVGDWLYFANFGAYTSSAATPFNGFEAAVEVIYIDTA"
     MIAKEIAPAL AQDQPEEVKH DSLCQARDHV TTGLAGLVAT DPTTQKTGAH EQAHQAVFQA        60
     MKEHVERVNK DTCDAGEENS FFVCDLGEVE RLLRYWRREL PRVQPYYAVK CNPDVRVLER       120
     LASLGVNFDC ASKAEIERVL QLGVAPERII YANPCKVSSF IRFAAARGVR QSTFDNVEEL       180
     YKIARFHPES QLLLRISTDD STAQCQLSAK YGCSPDEVDP LLAKVAELGL NLVGVSFHIG       240
     SGASDFSSLT QAVVDARRVF DRAAHFGLPA LRVLDVGGGF QFDTFHQSSA ILNAALDTHF       300
     PPGSGVELIA EPGRFLVATA FTLSSHVIAK RELPERGSML YINDGIYANM NCILFDHYQP       360
     TPRVLYHAAA FHYFDTTSSK SRTAACPHRT SIWGPTCDGL DCITDEYYLR YDLAVGDWLY       420
     FANFGAYTSS AATPFNGFEA AVEVIYIDTA                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page