(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE48

ASHGO_5.PE48         Location/Qualifiers
FT   CDS             complement(81183..82196)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18929434"
FT                   /locus_tag="AGOS_AEL298C"
FT                   /product="AEL298Cp"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52386.2"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059097"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001DB296E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758Q1"
FT                   /transl_table=1
FT                   /translation="MLSSIAIDNQHADKTLPPLLLLPPVIHTEAQAAGGTGATTPVSSY
FT                   DAGLAGYGAGYEEGEADAAAEHKPVSPYSETSTTSSSLERLAFLATRKGDGSGQYGAAP
FT                   DAYYVGRQAPAYQTPFYGGTVAPGAARSLTPNGAPRLQYEATYNTPRSPESARGVSMSP
FT                   LMSESASGFQRGDVQRTGSPPNSLLQEPTVITASKYKRQRTGPSCDICRSKKIKCDATI
FT                   TILFQDASVTGSFNEMLHAPVNVSELANEWLSQIPDEVRQALLTKELTLLKHVDKLIAF
FT                   KPCTSCSKRKNCFCTFSKGFTRADINVYTNLCVKFGKRSSIDQFSLNDYRNCGYQV"
     MLSSIAIDNQ HADKTLPPLL LLPPVIHTEA QAAGGTGATT PVSSYDAGLA GYGAGYEEGE        60
     ADAAAEHKPV SPYSETSTTS SSLERLAFLA TRKGDGSGQY GAAPDAYYVG RQAPAYQTPF       120
     YGGTVAPGAA RSLTPNGAPR LQYEATYNTP RSPESARGVS MSPLMSESAS GFQRGDVQRT       180
     GSPPNSLLQE PTVITASKYK RQRTGPSCDI CRSKKIKCDA TITILFQDAS VTGSFNEMLH       240
     APVNVSELAN EWLSQIPDEV RQALLTKELT LLKHVDKLIA FKPCTSCSKR KNCFCTFSKG       300
     FTRADINVYT NLCVKFGKRS SIDQFSLNDY RNCGYQV                                337
//

If you have problems or comments...

PBIL Back to PBIL home page