(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE6

ASHGO_5.PE6          Location/Qualifiers
FT   CDS             10760..11911
FT                   /codon_start=1
FT                   /gene_family="HOG000154325" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15755764"
FT                   /gene_name="SIL1"
FT                   /locus_tag="AEL340W"
FT                   /product="Nucleotide exchange factor SIL1 "
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum lumen "
FT                   /protein_id="AAS52344.1"
FT                   /db_xref="GO:0005788"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059163"
FT                   /db_xref="HOGENOM:HBG202778"
FT                   /db_xref="UniParc:UPI0000252C18"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758U2"
FT                   /transl_table=1
FT                   /translation="MYWKKLLFAIASAAALAAVDPETEGSELQTICSGGECYPRLFKAL
FT                   QDWSTIKEGQQIPPGLDIRVDLSTGKKQARLPIPNEASNMENGIQVVDDSSDYEFTKEF
FT                   QLVRAQVASGAPDYNVVIKQLDDLVEYASDYTLGYKIITHEFTLLQELIFGQDVPISVK
FT                   ELSSRIIVACLRNNTPCLDFVNTRFPDFVRHLLQEAVDYGRQATDAVEARTQIKRYLSI
FT                   VEPLLINEPQPINEEALKQLYEVNDQTVQLKVLLIMARLYKGRSHNDDISKRSLESTDV
FT                   QRWTTELSKAIQSKHLDDFHVRELFHGLYALKKEHGRAVKTYPTFLGWLAEETEARKQR
FT                   MTQDKQPRDLEQMEFDRLLIESRHMVFGNPMAHRIKNMEYDEL"
     MYWKKLLFAI ASAAALAAVD PETEGSELQT ICSGGECYPR LFKALQDWST IKEGQQIPPG        60
     LDIRVDLSTG KKQARLPIPN EASNMENGIQ VVDDSSDYEF TKEFQLVRAQ VASGAPDYNV       120
     VIKQLDDLVE YASDYTLGYK IITHEFTLLQ ELIFGQDVPI SVKELSSRII VACLRNNTPC       180
     LDFVNTRFPD FVRHLLQEAV DYGRQATDAV EARTQIKRYL SIVEPLLINE PQPINEEALK       240
     QLYEVNDQTV QLKVLLIMAR LYKGRSHNDD ISKRSLESTD VQRWTTELSK AIQSKHLDDF       300
     HVRELFHGLY ALKKEHGRAV KTYPTFLGWL AEETEARKQR MTQDKQPRDL EQMEFDRLLI       360
     ESRHMVFGNP MAHRIKNMEY DEL                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page