(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE63

ASHGO_5.PE63         Location/Qualifiers
FT   CDS             complement(105716..107155)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15755789"
FT                   /locus_tag="AGOS_AEL284C"
FT                   /product="AEL284Cp"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS52400.2"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059173"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI0001DB2976"
FT                   /db_xref="UniProtKB/TrEMBL:Q758N9"
FT                   /transl_table=1
FT                   /translation="MHGNHRYKVGRLIQSGSFSVVHHAQDCQTGQDVALKYVRKPHDNP
FT                   EQLQKVAALVHNEYAILRRLGTHRNICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIR
FT                   ERPTMRINFHSFLFQLCSAISYCHSKDVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSV
FT                   SKDYCIGTEKYLAPETFLREYHNTFATDYWSLGITIFCLMFGSCPFESASTAAPKRSAN
FT                   FQRFLRDPHRFVESYYLDAMFAELAPPASLGSLVGLCNADCAPSYWLELPKDRILFLCA
FT                   IANLVITHLVNVDPAARDMHAFWEKVNALFLENGSGRMLQKEALVPQPKSCENDGGEAN
FT                   VPASPISRSQTQYTSDQGSNYMNPHAFGTAAHAAGTGASSVALTATPSLCDWLHTTPAA
FT                   PRSVGADPYQDLLDAAVEDAIRQGSLAGFDQKGLEQDSRDGHGTGSCDGDLWSLSELRP
FT                   YSTMATATSHETENKCRGWIF"
     MHGNHRYKVG RLIQSGSFSV VHHAQDCQTG QDVALKYVRK PHDNPEQLQK VAALVHNEYA        60
     ILRRLGTHRN ICQLLDFYED ADTYVFVLEY CAYGDLYDFI KAIRERPTMR INFHSFLFQL       120
     CSAISYCHSK DVSHRDIKPE NVLMDDRGQV KLTDFGLSQI GSVSKDYCIG TEKYLAPETF       180
     LREYHNTFAT DYWSLGITIF CLMFGSCPFE SASTAAPKRS ANFQRFLRDP HRFVESYYLD       240
     AMFAELAPPA SLGSLVGLCN ADCAPSYWLE LPKDRILFLC AIANLVITHL VNVDPAARDM       300
     HAFWEKVNAL FLENGSGRML QKEALVPQPK SCENDGGEAN VPASPISRSQ TQYTSDQGSN       360
     YMNPHAFGTA AHAAGTGASS VALTATPSLC DWLHTTPAAP RSVGADPYQD LLDAAVEDAI       420
     RQGSLAGFDQ KGLEQDSRDG HGTGSCDGDL WSLSELRPYS TMATATSHET ENKCRGWIF        479
//

If you have problems or comments...

PBIL Back to PBIL home page