(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE70

ASHGO_5.PE70         Location/Qualifiers
FT   CDS             complement(117929..119908)
FT                   /codon_start=1
FT                   /gene_family="HOG000034130" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081014"
FT                   /gene_name="ATG13"
FT                   /locus_tag="AEL277C"
FT                   /product="Autophagy-related protein 13 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS52407.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059207"
FT                   /db_xref="HOGENOM:HBG204015"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="UniParc:UPI0000252C57"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758N2"
FT                   /transl_table=1
FT                   /translation="MAMESECNVVELIGGFFLKATLLVCQPRTGAIEGDGEEDRTFNIS
FT                   SAADAGVAEAVRAWTAYDGAQELPPLVIEMFLDLRRLGPQHTVVLKDQDGNPWNVCKGG
FT                   KKSEIMLERWLVELDVGNEEARPEEPPNAAEIYKQLVLLFRYLYTLTQLLPANELYARL
FT                   HGPSNQGEAAMPLINIGTRILDGSKPILSKGRVGLSRSIIATYTNVINETNVASHLEQK
FT                   KITPISTGYGSLRITVSYRRDCNFDVNEVLDYEGNNCSSSSVVDTHTKPGVGPLSSLRR
FT                   VSIHSNRSMSISPQTVYSGTVIPDPSPQRKSSSSRIQPFKAGSVGSGSLAIARNPSGSS
FT                   AVATLRAQRSGSASISTHVADQAVGEPSSVGSGGSKYSSSFGKIRRQSSMRRSGSLELP
FT                   AAKQAKPGERGSDELLDFVKMLEEKQELNVKKLYGTTTDISSSLVRFQSMKSNNDTLSE
FT                   DLSMSYSLEPTHAPQVRYRSNSHSPIPSISPSVQYTSIPMRLSQSRNVSQTELASRKNS
FT                   AERLKTLISSRTGSFSESRRQSNAGQEDILEDEDDEAEEILLSKSHLSNPTGTRLQSMS
FT                   PQSLKSISSYNRAAVPFKPVSNFSCPTTMATPAHAKLHKASISSSPDNQSGLVKKDHEH
FT                   STMTGGDDDDDLLFFMSDMNLSSQ"
     MAMESECNVV ELIGGFFLKA TLLVCQPRTG AIEGDGEEDR TFNISSAADA GVAEAVRAWT        60
     AYDGAQELPP LVIEMFLDLR RLGPQHTVVL KDQDGNPWNV CKGGKKSEIM LERWLVELDV       120
     GNEEARPEEP PNAAEIYKQL VLLFRYLYTL TQLLPANELY ARLHGPSNQG EAAMPLINIG       180
     TRILDGSKPI LSKGRVGLSR SIIATYTNVI NETNVASHLE QKKITPISTG YGSLRITVSY       240
     RRDCNFDVNE VLDYEGNNCS SSSVVDTHTK PGVGPLSSLR RVSIHSNRSM SISPQTVYSG       300
     TVIPDPSPQR KSSSSRIQPF KAGSVGSGSL AIARNPSGSS AVATLRAQRS GSASISTHVA       360
     DQAVGEPSSV GSGGSKYSSS FGKIRRQSSM RRSGSLELPA AKQAKPGERG SDELLDFVKM       420
     LEEKQELNVK KLYGTTTDIS SSLVRFQSMK SNNDTLSEDL SMSYSLEPTH APQVRYRSNS       480
     HSPIPSISPS VQYTSIPMRL SQSRNVSQTE LASRKNSAER LKTLISSRTG SFSESRRQSN       540
     AGQEDILEDE DDEAEEILLS KSHLSNPTGT RLQSMSPQSL KSISSYNRAA VPFKPVSNFS       600
     CPTTMATPAH AKLHKASISS SPDNQSGLVK KDHEHSTMTG GDDDDDLLFF MSDMNLSSQ        659
//

If you have problems or comments...

PBIL Back to PBIL home page