(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE76

ASHGO_5.PE76         Location/Qualifiers
FT   CDS             complement(130780..131871)
FT                   /codon_start=1
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18081017"
FT                   /locus_tag="AGOS_AEL271C"
FT                   /product="AEL271Cp"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52413.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059236"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0001DB298F"
FT                   /db_xref="UniProtKB/TrEMBL:Q758M6"
FT                   /transl_table=1
FT                   /translation="MEEHTSTAGDANRPAKAYEQMEGEQKLDNDEIALYDRQIRLWGMA
FT                   AQARMRNTRVLLVNFGALGGEVAKNLVLSGIGSLTILDNRVAAAEDLGSQFLLAEEDLG
FT                   RLRAEVGAARLRDMNPRVSLAVDARNVTEQPAEYFAGHDLVVATDCSRADLEKINAACR
FT                   ARGVPFYAGGLHGLWGYVFVDLVQFDSTEEKAVTVDAPITALGSVSERREVVTVRREHE
FT                   EDPRSAREIVTTRNYYRPFSEVLAQGTLAGRLTPRQLRRLLPALPLTLAAFLHGHGNDD
FT                   VASFEAEVKKMCHQLGSSPSNVPAECTELFLRQIGVELPPVAAVIGGAMAQDIINTMGK
FT                   RQSPLNNFVVLDGITLDMQIFEL"
     MEEHTSTAGD ANRPAKAYEQ MEGEQKLDND EIALYDRQIR LWGMAAQARM RNTRVLLVNF        60
     GALGGEVAKN LVLSGIGSLT ILDNRVAAAE DLGSQFLLAE EDLGRLRAEV GAARLRDMNP       120
     RVSLAVDARN VTEQPAEYFA GHDLVVATDC SRADLEKINA ACRARGVPFY AGGLHGLWGY       180
     VFVDLVQFDS TEEKAVTVDA PITALGSVSE RREVVTVRRE HEEDPRSARE IVTTRNYYRP       240
     FSEVLAQGTL AGRLTPRQLR RLLPALPLTL AAFLHGHGND DVASFEAEVK KMCHQLGSSP       300
     SNVPAECTEL FLRQIGVELP PVAAVIGGAM AQDIINTMGK RQSPLNNFVV LDGITLDMQI       360
     FEL                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page