(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE79

ASHGO_5.PE79         Location/Qualifiers
FT   CDS             135460..136428
FT                   /codon_start=1
FT                   /gene_family="HOG000180334" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI20624151"
FT                   /locus_tag="AEL268W"
FT                   /orf_name="AGOS_AEL268W"
FT                   /product="AEL268Wp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS52416.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG192245"
FT                   /db_xref="HOGENOM:HBG716455"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniParc:UPI0000252C60"
FT                   /db_xref="UniProtKB/TrEMBL:Q758V2"
FT                   /transl_table=1
FT                   /translation="MKLLKEKHISFIKSLDKKHEDFEYWVTEHLRLNGIYWGLTALCCL
FT                   GAKDAFDREDIIAFVKRCWDKRTGGFAAYEGHDAHLLTTLSGIQVLATYDALDTLTPQE
FT                   VEQCVNFIEGNQMADGSFQGDRFGEVDTRFVYTALSSLSILGRLSAKVVDPAVEFIKRC
FT                   YNFDGGFGLCPGAESHAAQAFTCIGALAIVGRLGDLSARQLEDIGWWLCERQVPEGGLN
FT                   GRPSKLPDVCYSWWVLSTLAILGKADWIDHEKLGDFILASQDPKSGGISDRPENQVDVF
FT                   HTLFGIAGLSLMKHDGLVPIDPIYCMPYDITEKFKKYPYET"
     MKLLKEKHIS FIKSLDKKHE DFEYWVTEHL RLNGIYWGLT ALCCLGAKDA FDREDIIAFV        60
     KRCWDKRTGG FAAYEGHDAH LLTTLSGIQV LATYDALDTL TPQEVEQCVN FIEGNQMADG       120
     SFQGDRFGEV DTRFVYTALS SLSILGRLSA KVVDPAVEFI KRCYNFDGGF GLCPGAESHA       180
     AQAFTCIGAL AIVGRLGDLS ARQLEDIGWW LCERQVPEGG LNGRPSKLPD VCYSWWVLST       240
     LAILGKADWI DHEKLGDFIL ASQDPKSGGI SDRPENQVDV FHTLFGIAGL SLMKHDGLVP       300
     IDPIYCMPYD ITEKFKKYPY ET                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page