(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE80

ASHGO_5.PE80         Location/Qualifiers
FT   CDS             complement(136477..138510)
FT                   /codon_start=1
FT                   /gene_family="HOG000246706" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15756847"
FT                   /gene_name="DPB2"
FT                   /locus_tag="AEL267C"
FT                   /product="DNA polymerase epsilon subunit B "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS52417.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG059259"
FT                   /db_xref="HOGENOM:HBG398250"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniParc:UPI0000252C61"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758V1"
FT                   /transl_table=1
FT                   /translation="MDRGSALPAEISPQLLRPLAYRVLSKKYGLHIKSDGLAQLAKFIG
FT                   NAFGVDWRRSAETMQFLERFAAIWREQERGLFVDALGVDAVTQELRERNKTAKQRRPAR
FT                   ARETTLDALVRPTEAYSAVESSGGDVTATEPMDEDTVREEPLDWTHYFKVIDTFSQQQF
FT                   TYDVTKRRYRLVQQRESAAGPLSTLLRIPSLEANLAQFPTRYHLVRDRVLRNASFQNDD
FT                   VYNPLSSMQQLQQQLDAGGAPLASTAYMSITQIKNLLGRDGKNFLLLGLIRKDSKGFWS
FT                   LEDPSGSIEIDISETYPTKGTYYVPGCIVLAEGIYSSAGNRFRVSSITHPPGERREAFL
FT                   EAIGNLDLLGIHGPSNESYISRLDKELKIRLHYLEKELTDHRFVFLGGNIFLDDTMTET
FT                   ALAKLFDVLEHDPPTVLVLPGSFTSTPIYPSSDSKSSSSTAAYRANFDALAKLLSKYER
FT                   LINETTFVFIPGDNDPWGSMAYLGVAGTLPQHPIPGDFVTKVNRICKHVVWGSNPTRIA
FT                   YLSQELVIMRDDMCNRFKRNSIIFPTVEEEQKQEYMLLQQELQDDERSSDLSISQLIKS
FT                   RDQLPASVQESRKIVKTILDQQHLSPFTSQVRPITWDYDYTLHLSPIPSTMIICDPTAP
FT                   KYDVTYNGCKSINPGSFLHKRSVNYTEYTPSLRKATEEEIVV"
     MDRGSALPAE ISPQLLRPLA YRVLSKKYGL HIKSDGLAQL AKFIGNAFGV DWRRSAETMQ        60
     FLERFAAIWR EQERGLFVDA LGVDAVTQEL RERNKTAKQR RPARARETTL DALVRPTEAY       120
     SAVESSGGDV TATEPMDEDT VREEPLDWTH YFKVIDTFSQ QQFTYDVTKR RYRLVQQRES       180
     AAGPLSTLLR IPSLEANLAQ FPTRYHLVRD RVLRNASFQN DDVYNPLSSM QQLQQQLDAG       240
     GAPLASTAYM SITQIKNLLG RDGKNFLLLG LIRKDSKGFW SLEDPSGSIE IDISETYPTK       300
     GTYYVPGCIV LAEGIYSSAG NRFRVSSITH PPGERREAFL EAIGNLDLLG IHGPSNESYI       360
     SRLDKELKIR LHYLEKELTD HRFVFLGGNI FLDDTMTETA LAKLFDVLEH DPPTVLVLPG       420
     SFTSTPIYPS SDSKSSSSTA AYRANFDALA KLLSKYERLI NETTFVFIPG DNDPWGSMAY       480
     LGVAGTLPQH PIPGDFVTKV NRICKHVVWG SNPTRIAYLS QELVIMRDDM CNRFKRNSII       540
     FPTVEEEQKQ EYMLLQQELQ DDERSSDLSI SQLIKSRDQL PASVQESRKI VKTILDQQHL       600
     SPFTSQVRPI TWDYDYTLHL SPIPSTMIIC DPTAPKYDVT YNGCKSINPG SFLHKRSVNY       660
     TEYTPSLRKA TEEEIVV                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page