(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE87

ASHGO_5.PE87         Location/Qualifiers
FT   CDS             complement(147826..149352)
FT                   /codon_start=1
FT                   /gene_family="HOG000093386" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081018"
FT                   /gene_name="JIP5"
FT                   /locus_tag="AEL261C"
FT                   /product="WD repeat-containing protein JIP5 "
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS52424.2"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="HOGENOM:HBG059267"
FT                   /db_xref="HOGENOM:HBG395775"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI0001DB2993"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758M2"
FT                   /transl_table=1
FT                   /translation="MGKKKNSKAYSEELTDTTRPLLEFRYGNPLFAIACHPEQSVIVSG
FT                   LATGHMFCHKYNAAELKEAQLKRLRKHDAGSKDDRKKLWEVVEVPGVETSGVSLLWTTK
FT                   RHKGSVRCICFDADGTHIYSVGTDNVLKKADTLTGKVVKKCVLDPGQNVKYTKLVKSAT
FT                   HPLVLLGDENGNVTVLNSESLEQTNLIKSIHNGDAINDIFHFAKKSVYRYISLGQTTLA
FT                   HWDSRESNEGDFAIAADDKQAKRKVILSDDQEDEILCGTFVDPEDGEVLVCGMGEGVLT
FT                   VWRPKKNGLADQLTRIKVKKNESIDCIVPTLEDDGCVWCGCSDGNIYKVHVNRGTIIEV
FT                   RKHSKLDEVTFLDLDSEYRLLSGGLDKAKLWDSEKSEQLTPGSDADDRVSNSSPSAGKS
FT                   SESDSNDSENDATSSGGSSDEDSSSDESEHSDASDVEEELVGLTREQIIAELDKDLVEE
FT                   SEDVEDVRSQRKRKHGADLPTNANGKKQKGKNIKPERSMKTHGIRRFEGL"
     MGKKKNSKAY SEELTDTTRP LLEFRYGNPL FAIACHPEQS VIVSGLATGH MFCHKYNAAE        60
     LKEAQLKRLR KHDAGSKDDR KKLWEVVEVP GVETSGVSLL WTTKRHKGSV RCICFDADGT       120
     HIYSVGTDNV LKKADTLTGK VVKKCVLDPG QNVKYTKLVK SATHPLVLLG DENGNVTVLN       180
     SESLEQTNLI KSIHNGDAIN DIFHFAKKSV YRYISLGQTT LAHWDSRESN EGDFAIAADD       240
     KQAKRKVILS DDQEDEILCG TFVDPEDGEV LVCGMGEGVL TVWRPKKNGL ADQLTRIKVK       300
     KNESIDCIVP TLEDDGCVWC GCSDGNIYKV HVNRGTIIEV RKHSKLDEVT FLDLDSEYRL       360
     LSGGLDKAKL WDSEKSEQLT PGSDADDRVS NSSPSAGKSS ESDSNDSEND ATSSGGSSDE       420
     DSSSDESEHS DASDVEEELV GLTREQIIAE LDKDLVEESE DVEDVRSQRK RKHGADLPTN       480
     ANGKKQKGKN IKPERSMKTH GIRRFEGL                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page