(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE94

ASHGO_5.PE94         Location/Qualifiers
FT   CDS             join(161376..161382,161584..162143)
FT                   /codon_start=1
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18081020"
FT                   /locus_tag="AEL255W"
FT                   /orf_name="AGOS_AEL255W"
FT                   /product="AEL255Wp"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="AAS52430.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG053230"
FT                   /db_xref="HOGENOM:HBG588353"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI0000252C6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q758L6"
FT                   /transl_table=1
FT                   /translation="MPRAPRTYSKTYSTPKRPYESARLDAELKLAGEYGLKNKREIYRI
FT                   SFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIEDF
FT                   LERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNVPSFMVRLDSEKHIDFAVTSP
FT                   FGGGRPGRVARKRAAAAAGGAEDEE"
     MPRAPRTYSK TYSTPKRPYE SARLDAELKL AGEYGLKNKR EIYRISFQLS KIRRAARDLL        60
     TRDEKDPKRL FEGNALIRRL VRIGVLSEDK KKLDYVLALK IEDFLERRLQ TQVYKLGLAK       120
     SVHHARVLIT QRHIAVGKQI VNVPSFMVRL DSEKHIDFAV TSPFGGGRPG RVARKRAAAA       180
     AGGAEDEE                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page