(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_5.PE98

ASHGO_5.PE98         Location/Qualifiers
FT   CDS             join(complement(166901..166971),complement(166113..166752))
FT                   /codon_start=1
FT                   /gene_family="HOG000158315" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20624153"
FT                   /gene_name="ATP4"
FT                   /locus_tag="AEL251C"
FT                   /product="ATP synthase subunit 4, mitochondrial "
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="AAS52434.2"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="HOGENOM:HBG057729"
FT                   /db_xref="HOGENOM:HBG328743"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniParc:UPI0001DB29A9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q758L2"
FT                   /transl_table=1
FT                   /translation="MAFRALTTKAAARPLLALGPRSVAMGARYMSTPAPQDPKSKAAAI
FT                   LDSLPGSTALSKTGILATSAAAAIYAISNELYVLNAETILLCTFTGFSFLIAKLVAPAY
FT                   KEYADKRMQHVSGILNSSRNKHVAAVKERIESVSELKNVTETTKVLFEVSKETLELEAK
FT                   AFELKQKVDLATEAKAVLDSWVRYEASVRQLQQKQIAESVIGKVQAELANPKFQDKVLQ
FT                   QSVADVEKLFASLK"
     MAFRALTTKA AARPLLALGP RSVAMGARYM STPAPQDPKS KAAAILDSLP GSTALSKTGI        60
     LATSAAAAIY AISNELYVLN AETILLCTFT GFSFLIAKLV APAYKEYADK RMQHVSGILN       120
     SSRNKHVAAV KERIESVSEL KNVTETTKVL FEVSKETLEL EAKAFELKQK VDLATEAKAV       180
     LDSWVRYEAS VRQLQQKQIA ESVIGKVQAE LANPKFQDKV LQQSVADVEK LFASLK           236
//

If you have problems or comments...

PBIL Back to PBIL home page