(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE104

ASHGO_7.PE104        Location/Qualifiers
FT   CDS             complement(209407..210690)
FT                   /codon_start=1
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749063"
FT                   /locus_tag="AGL267C"
FT                   /orf_name="AGOS_AGL267C"
FT                   /product="AGL267Cp"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54224.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI0000253357"
FT                   /db_xref="UniProtKB/TrEMBL:Q751H3"
FT                   /transl_table=1
FT                   /translation="MAVLLSKKVIRVALLSSVVLLFLGLLSGHQDVQEYMPDSVRDMHS
FT                   SVKGSLTGVWGGRTEAVVEETKSDAGVAHADSGAERSKAPAKAKEPAEEWMRKPAPVQA
FT                   DGKVRASFVSLVRNSQLEGIIPAIKLVEQRFNHKYHYPWLFLNDEPFNEEFKTEIRKVV
FT                   SSEARFETIPKEHWSFPEWIDQDKAAETREKMKGIIYGDSVSYRHMCRFESGFFWRHPA
FT                   LEDYDWYWRVEPDTKLFCDIDYDVFRWMQDNDKVYGFTISIHEFQATIPTLWETTTNFI
FT                   KKHPEYVAKDNMQGFISDDNGKTYNLCHFWSNFEIASLNFWRSKPYREYFDYLDQAGGF
FT                   FYERWGDAPVHSIAASLFLPKDKIHFFNDIAYYHGPFTHCPIEKDVFQKGNCDCNPDDD
FT                   FTFQGYACGHKYYEVNSMKKPPGYERFQ"
     MAVLLSKKVI RVALLSSVVL LFLGLLSGHQ DVQEYMPDSV RDMHSSVKGS LTGVWGGRTE        60
     AVVEETKSDA GVAHADSGAE RSKAPAKAKE PAEEWMRKPA PVQADGKVRA SFVSLVRNSQ       120
     LEGIIPAIKL VEQRFNHKYH YPWLFLNDEP FNEEFKTEIR KVVSSEARFE TIPKEHWSFP       180
     EWIDQDKAAE TREKMKGIIY GDSVSYRHMC RFESGFFWRH PALEDYDWYW RVEPDTKLFC       240
     DIDYDVFRWM QDNDKVYGFT ISIHEFQATI PTLWETTTNF IKKHPEYVAK DNMQGFISDD       300
     NGKTYNLCHF WSNFEIASLN FWRSKPYREY FDYLDQAGGF FYERWGDAPV HSIAASLFLP       360
     KDKIHFFNDI AYYHGPFTHC PIEKDVFQKG NCDCNPDDDF TFQGYACGHK YYEVNSMKKP       420
     PGYERFQ                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page