(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE119

ASHGO_7.PE119        Location/Qualifiers
FT   CDS             230549..232936
FT                   /codon_start=1
FT                   /gene_family="HOG000141904" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749067"
FT                   /locus_tag="AGL252W"
FT                   /orf_name="AGOS_AGL252W"
FT                   /product="AGL252Wp"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54239.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG145239"
FT                   /db_xref="HOGENOM:HBG203921"
FT                   /db_xref="InterPro:IPR006925"
FT                   /db_xref="InterPro:IPR006926"
FT                   /db_xref="InterPro:IPR016534"
FT                   /db_xref="UniParc:UPI0000253366"
FT                   /db_xref="UniProtKB/TrEMBL:Q751F8"
FT                   /transl_table=1
FT                   /translation="MNPSLGWEKLSDVYYRNRPLCTWDWSHASDLNYSFSLTFCALHHD
FT                   QKIHCYNYVGELQWSIDCSGLPSEIVNFEFAKNETFILVLEDRIRRYTGWYPLQWEDTM
FT                   LPDSVSDLIWDYKSGVALLQSSQDIYYYHDSRLELIYQNDDRFTLSTKHHWHTNGGLVV
FT                   LLDTRVVLHLDIPTRKLSHAVAGSWQEVRISPKGFVCLYSMRENSIAIYKDPSRFLLEH
FT                   SLDVIPDALEWCGSDTIAYCNYKNEEVKLIGPNGSYVAFWFPNPIIALRTEVDGVKVLT
FT                   SASINFISKVENYTARIFSIGSTESSAILLDSLELLSNHAPRAIENLKVINLEQAVLEC
FT                   TQAARDEFAPYWQKRLLSAASFGKDSLSNAEFNSQAFVQTCDLLRVLNMLSQMGLPLTA
FT                   KQFDDITIDGVLEILMRLHKFHKCIQICSFLNYEKKLGNVFKEWAVAKIKLSPDVDDSA
FT                   LYQSIITQMTNQGLVPGTSLIQIARAAFLEGRFHLAKKLAVESPLPRSKLQLLLDMDEN
FT                   ELALSEAVKLLDPELTLTLLLLLRSRLTNAQFTKVLVLVLKDNTLLQFYERNNMVFLYD
FT                   FYRQTDRYQELAMLIFNDGKKRNALLSFLPQVQNLYGIIDTPLAKENKELISRHISLVK
FT                   HQQNLTSLLNYDFTDLTLDATLTQLIEMGQERHTSTLVKTFKISERKYYRIKCRTLVKA
FT                   GRFDELNKFAKERKSPIGYKPFYEAVFNHGNPREAAVYVSMITGISNYEKIELYLKCGS
FT                   FYDAIQLASREKDIALLQRIKEQLPDNQPQLMVVLKESIAKL"
     MNPSLGWEKL SDVYYRNRPL CTWDWSHASD LNYSFSLTFC ALHHDQKIHC YNYVGELQWS        60
     IDCSGLPSEI VNFEFAKNET FILVLEDRIR RYTGWYPLQW EDTMLPDSVS DLIWDYKSGV       120
     ALLQSSQDIY YYHDSRLELI YQNDDRFTLS TKHHWHTNGG LVVLLDTRVV LHLDIPTRKL       180
     SHAVAGSWQE VRISPKGFVC LYSMRENSIA IYKDPSRFLL EHSLDVIPDA LEWCGSDTIA       240
     YCNYKNEEVK LIGPNGSYVA FWFPNPIIAL RTEVDGVKVL TSASINFISK VENYTARIFS       300
     IGSTESSAIL LDSLELLSNH APRAIENLKV INLEQAVLEC TQAARDEFAP YWQKRLLSAA       360
     SFGKDSLSNA EFNSQAFVQT CDLLRVLNML SQMGLPLTAK QFDDITIDGV LEILMRLHKF       420
     HKCIQICSFL NYEKKLGNVF KEWAVAKIKL SPDVDDSALY QSIITQMTNQ GLVPGTSLIQ       480
     IARAAFLEGR FHLAKKLAVE SPLPRSKLQL LLDMDENELA LSEAVKLLDP ELTLTLLLLL       540
     RSRLTNAQFT KVLVLVLKDN TLLQFYERNN MVFLYDFYRQ TDRYQELAML IFNDGKKRNA       600
     LLSFLPQVQN LYGIIDTPLA KENKELISRH ISLVKHQQNL TSLLNYDFTD LTLDATLTQL       660
     IEMGQERHTS TLVKTFKISE RKYYRIKCRT LVKAGRFDEL NKFAKERKSP IGYKPFYEAV       720
     FNHGNPREAA VYVSMITGIS NYEKIELYLK CGSFYDAIQL ASREKDIALL QRIKEQLPDN       780
     QPQLMVVLKE SIAKL                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page