(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE122

ASHGO_7.PE122        Location/Qualifiers
FT   CDS             complement(236606..238351)
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927776"
FT                   /gene_name="SSN3"
FT                   /gene_synonym="CDK8"
FT                   /locus_tag="AGL249C"
FT                   /product="Serine/threonine-protein kinase SSN3 "
FT                   /EC_number="2.7.11.22"
FT                   /EC_number="2.7.11.23"
FT                   /function="ATP binding"
FT                   /function="RNA polymerase II carboxy-terminal domain kinase
FT                   activity"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /function="metal ion binding"
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54242.2"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0008353"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="HSSP:1V0B"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB2B16"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751F5"
FT                   /transl_table=1
FT                   /translation="MGIRLQSSDSMNNQHQTQQNKYFNVSNQASTRSLWSQQQQQQLLD
FT                   TKGSASTSKSPMLMANNNVFSIGPYRQRKDAGRVSVLEKYEIIGYIAAGTYGKVYKAKA
FT                   KETQEEQENSIHTHNQTLGSVSVAGIDGGMASREVENGGDDPLRLDGHGGIAVAPAAGG
FT                   GLSSAAAHRARSNGAVKALPKKSAFTPFYAIKKFKTEREGVEQLHYTGISQSACREMSL
FT                   CRELDNKHLTKLVEIFLERKSIYMVSEFAEHDLLQIIHFHSHPEKRLIAPRMLKSIMWQ
FT                   ILDGVSYLHQNWILHRDLKPANIMVTVDGCVKIGDLGLARKFYNLVQTLYTGDKVVVTI
FT                   WYRAPELLLGARHYSPAIDLWAVGCIFAELIGLRPIFKGEEAKMDSKKSVPFQGNQLQR
FT                   ILEVLGTPTHHTWPNIHKYPEYEQLSKFSKYRDNLSVWYHSSGGRDKAALSLLYSLLKY
FT                   DPITRIDAIDALEHEYFTNNDPPVSSDVFEGLSYKYPPRRIHTSDNDIMNVGANKNKSG
FT                   FNHHPPQQQTVNNNGVTNSSIGGLGVNRRILAAAAAAAAAVQVNGTNIVSGSSSSNGPI
FT                   RKKKR"
     MGIRLQSSDS MNNQHQTQQN KYFNVSNQAS TRSLWSQQQQ QQLLDTKGSA STSKSPMLMA        60
     NNNVFSIGPY RQRKDAGRVS VLEKYEIIGY IAAGTYGKVY KAKAKETQEE QENSIHTHNQ       120
     TLGSVSVAGI DGGMASREVE NGGDDPLRLD GHGGIAVAPA AGGGLSSAAA HRARSNGAVK       180
     ALPKKSAFTP FYAIKKFKTE REGVEQLHYT GISQSACREM SLCRELDNKH LTKLVEIFLE       240
     RKSIYMVSEF AEHDLLQIIH FHSHPEKRLI APRMLKSIMW QILDGVSYLH QNWILHRDLK       300
     PANIMVTVDG CVKIGDLGLA RKFYNLVQTL YTGDKVVVTI WYRAPELLLG ARHYSPAIDL       360
     WAVGCIFAEL IGLRPIFKGE EAKMDSKKSV PFQGNQLQRI LEVLGTPTHH TWPNIHKYPE       420
     YEQLSKFSKY RDNLSVWYHS SGGRDKAALS LLYSLLKYDP ITRIDAIDAL EHEYFTNNDP       480
     PVSSDVFEGL SYKYPPRRIH TSDNDIMNVG ANKNKSGFNH HPPQQQTVNN NGVTNSSIGG       540
     LGVNRRILAA AAAAAAAVQV NGTNIVSGSS SSNGPIRKKK R                           581
//

If you have problems or comments...

PBIL Back to PBIL home page