(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE129

ASHGO_7.PE129        Location/Qualifiers
FT   CDS             join(complement(250103..250119),complement(249161..250049))
FT                   /codon_start=1
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079004"
FT                   /gene_name="PHO85"
FT                   /locus_tag="AGL242C"
FT                   /product="Negative regulator of the PHO system "
FT                   /EC_number="2.7.11.22"
FT                   /function="ATP binding"
FT                   /function="cyclin-dependent protein kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="AAS54249.2"
FT                   /db_xref="GO:0004693"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001DB2B18"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751E8"
FT                   /transl_table=1
FT                   /translation="MTSTSQFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEG
FT                   TPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRG
FT                   LELSLVKYFQWQLLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVN
FT                   TFSSEVVTLWYRAPDVLMGSRTYCTSIDIWSCGCILAEMIMGKALFPGTNDDEQLKLIF
FT                   ETMGTPTEQTWVGVSQLPKYNPQIPLYPNKDIKQLLQATTKEQISDVLVNLIQGLLQLN
FT                   PSMRLSAQQALSHPLFEEYH"
     MTSTSQFKQL ERLGNGTYAT VYKGLNKTTG LYVALKEVKL DSEEGTPSTA IREISLMKEL        60
     KHENIVRLYD VIHTENKLTL VFEFMDNDLK KFMDSRLDRE MPRGLELSLV KYFQWQLLQG       120
     VAFCHENRIL HRDLKPQNLL INNKGQLKLG DFGLARAFGI PVNTFSSEVV TLWYRAPDVL       180
     MGSRTYCTSI DIWSCGCILA EMIMGKALFP GTNDDEQLKL IFETMGTPTE QTWVGVSQLP       240
     KYNPQIPLYP NKDIKQLLQA TTKEQISDVL VNLIQGLLQL NPSMRLSAQQ ALSHPLFEEY       300
     H                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page