(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE13

ASHGO_7.PE13         Location/Qualifiers
FT   CDS             complement(32992..35412)
FT                   /codon_start=1
FT                   /gene_family="HOG000094405" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19774748"
FT                   /gene_name="YME2"
FT                   /locus_tag="AGL358C"
FT                   /product="Mitochondrial escape protein 2 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="AAS54133.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059754"
FT                   /db_xref="HOGENOM:HBG397948"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018850"
FT                   /db_xref="UniParc:UPI00002532FE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P7"
FT                   /transl_table=1
FT                   /translation="MMFLEMQRAFMLHGRRAVTRSAVGVRYISEDIQQKDAQAGEKATA
FT                   TATGVIYKSDEETLMYFDNVYPRATSLWRPTQWYNILLSNQSREAVREKIMRLASPASN
FT                   PVHGLELRSTIPIKRDGGVFATFRVPREYTRAQVNALIQANTQQESSKSLLAAFTRAAA
FT                   FPVKGVPWIEDLKRLPNNVVRVEVEGPALSEEELYSLFRRYGTILDIYPAGKNGYATIR
FT                   YRSFRGAICAKNCVSGIEINGSTLHVKFEPVVRAHAIRDFFVNHPRIAIPLLIALLSIC
FT                   AVLIFDPIREFSIEQKITRMYTLSRDNFVVKSILRLTSYTVSSVKHLWGYDDDQPEKRQ
FT                   LWQERVEKVNDLKMWLEENNNTFVVVTGPRGSGKHELVMQHTLHDRPNVLYLDCDTLIK
FT                   SRTDSKFLRNAAHQIGYFPIFPWLNSVTTLVDLAVQGLTGQKSGLSESKETQFRNMLNT
FT                   AMMSIRHIALSGYKATLHSGDDVTTVKEEDYLQQHPERKPVIVIDRFSNKAEINGFVYK
FT                   ELADWASMLVQMNIAHVIFLTESVSPNQLLAEALPNQVFKFLFLSDASKDSARSYVLSQ
FT                   LYPSSPAYSEKMPAADADANEEYRKEIDRALEPIGGRMLDLQAFVRRVKSGEEPSEALE
FT                   KMVEQASEQITQIFLSERSEPIKTAQAWELIELLSQNDVVKYGDIVFRPLFKSSPEAGL
FT                   LELEKNGLITISRNRGVLQDIRPAKPLFKAAFSYLLQDKDLSIVLRTGYYLRLIAFETG
FT                   RIKKWEEELRLLAKVSDQRICKSRLNYLASKIDASSGVINSCEDKVKEMSKRI"
     MMFLEMQRAF MLHGRRAVTR SAVGVRYISE DIQQKDAQAG EKATATATGV IYKSDEETLM        60
     YFDNVYPRAT SLWRPTQWYN ILLSNQSREA VREKIMRLAS PASNPVHGLE LRSTIPIKRD       120
     GGVFATFRVP REYTRAQVNA LIQANTQQES SKSLLAAFTR AAAFPVKGVP WIEDLKRLPN       180
     NVVRVEVEGP ALSEEELYSL FRRYGTILDI YPAGKNGYAT IRYRSFRGAI CAKNCVSGIE       240
     INGSTLHVKF EPVVRAHAIR DFFVNHPRIA IPLLIALLSI CAVLIFDPIR EFSIEQKITR       300
     MYTLSRDNFV VKSILRLTSY TVSSVKHLWG YDDDQPEKRQ LWQERVEKVN DLKMWLEENN       360
     NTFVVVTGPR GSGKHELVMQ HTLHDRPNVL YLDCDTLIKS RTDSKFLRNA AHQIGYFPIF       420
     PWLNSVTTLV DLAVQGLTGQ KSGLSESKET QFRNMLNTAM MSIRHIALSG YKATLHSGDD       480
     VTTVKEEDYL QQHPERKPVI VIDRFSNKAE INGFVYKELA DWASMLVQMN IAHVIFLTES       540
     VSPNQLLAEA LPNQVFKFLF LSDASKDSAR SYVLSQLYPS SPAYSEKMPA ADADANEEYR       600
     KEIDRALEPI GGRMLDLQAF VRRVKSGEEP SEALEKMVEQ ASEQITQIFL SERSEPIKTA       660
     QAWELIELLS QNDVVKYGDI VFRPLFKSSP EAGLLELEKN GLITISRNRG VLQDIRPAKP       720
     LFKAAFSYLL QDKDLSIVLR TGYYLRLIAF ETGRIKKWEE ELRLLAKVSD QRICKSRLNY       780
     LASKIDASSG VINSCEDKVK EMSKRI                                            806
//

If you have problems or comments...

PBIL Back to PBIL home page