(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE139

ASHGO_7.PE139        Location/Qualifiers
FT   CDS             join(complement(268994..269038),complement(267782..268930))
FT                   /codon_start=1
FT                   /gene_family="HOG000081923" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15749079"
FT                   /gene_name="MVD1"
FT                   /locus_tag="AGL232C"
FT                   /product="Diphosphomevalonate decarboxylase "
FT                   /EC_number="4.1.1.33"
FT                   /function="ATP binding"
FT                   /function="diphosphomevalonate decarboxylase activity "
FT                   /function="kinase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /biological_process="sterol biosynthetic process "
FT                   /protein_id="AAS54259.2"
FT                   /db_xref="GO:0004163"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016126"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG089900"
FT                   /db_xref="HOGENOM:HBG502799"
FT                   /db_xref="HSSP:1FI4"
FT                   /db_xref="InterPro:IPR005935"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI0001DB2B34"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751D8"
FT                   /transl_table=1
FT                   /translation="MSIYVASTTAPVNIATLKYWGKRDSMLNLPTNSSISVTLSQEDLR
FT                   TLTSAATGPELAEDRLWLNGKPESLGNARTQQCLADLRALRRALETEEPDLPRMSEWKL
FT                   HIVSENNFPTAAGLASSAAGFAALVVAVAKLYGLPQDYSEISKIARKGSGSACRSLYGG
FT                   YVAWEMGAEADGSDSRAVQIADVEHWPEMRAAILVVSADRKDTPSTSGMQQTVHTSDLF
FT                   KERVATVVPRRYGEMAAAIRARDFATFARLTMQDSNSFHATCLDSFPPIFYMNDTSRRI
FT                   VKLCHLINEFYNETIVAYTFDAGPNAVLYYLAENEARLCGFLSAVFGANDGWETTFSTE
FT                   QRATFAAQFDECVRGKLATDLDDELHRGVARLIFTKVGPGPQDTKSSLIDPETGLPR"
     MSIYVASTTA PVNIATLKYW GKRDSMLNLP TNSSISVTLS QEDLRTLTSA ATGPELAEDR        60
     LWLNGKPESL GNARTQQCLA DLRALRRALE TEEPDLPRMS EWKLHIVSEN NFPTAAGLAS       120
     SAAGFAALVV AVAKLYGLPQ DYSEISKIAR KGSGSACRSL YGGYVAWEMG AEADGSDSRA       180
     VQIADVEHWP EMRAAILVVS ADRKDTPSTS GMQQTVHTSD LFKERVATVV PRRYGEMAAA       240
     IRARDFATFA RLTMQDSNSF HATCLDSFPP IFYMNDTSRR IVKLCHLINE FYNETIVAYT       300
     FDAGPNAVLY YLAENEARLC GFLSAVFGAN DGWETTFSTE QRATFAAQFD ECVRGKLATD       360
     LDDELHRGVA RLIFTKVGPG PQDTKSSLID PETGLPR                                397
//

If you have problems or comments...

PBIL Back to PBIL home page