(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE156

ASHGO_7.PE156        Location/Qualifiers
FT   CDS             294460..295461
FT                   /codon_start=1
FT                   /gene_family="HOG000142018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749089"
FT                   /gene_name="AIM39"
FT                   /locus_tag="AGL215W"
FT                   /product="Altered inheritance of mitochondria protein 39,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="AAS54276.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG059770"
FT                   /db_xref="HOGENOM:HBG202767"
FT                   /db_xref="UniParc:UPI000025338B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751C1"
FT                   /transl_table=1
FT                   /translation="MIRLLGLTTRRVAVRTPVTALYSTGKPIDPKHIFTDPQTNRIRDP
FT                   PNYFQKGRGRGTEDAPLPADMHYGMGAQEAVSEAIGASIRQQRARKRRGILLALVVAVF
FT                   GTVFGYSIGYRVFYKHSESFLPLWPAKRSRPLSEKDAANLRVAEVKRMAEFRVFERLSM
FT                   HKMIKEQFGVPLHTQDGKKPETNVFVLWCEDQDPCITGLLFRPSGSHAPDHGHTWHDFL
FT                   GLVQWRVTHRPVSIRNAAERVLNFIGLGTSDLFQMVDPSKVYGDFKYEFPLPKRNDNDH
FT                   AMHICFLGEMPLGPDSLVVYRGKYHVGVRLDQVDLFRREDGKLIRYVLYKNS"
     MIRLLGLTTR RVAVRTPVTA LYSTGKPIDP KHIFTDPQTN RIRDPPNYFQ KGRGRGTEDA        60
     PLPADMHYGM GAQEAVSEAI GASIRQQRAR KRRGILLALV VAVFGTVFGY SIGYRVFYKH       120
     SESFLPLWPA KRSRPLSEKD AANLRVAEVK RMAEFRVFER LSMHKMIKEQ FGVPLHTQDG       180
     KKPETNVFVL WCEDQDPCIT GLLFRPSGSH APDHGHTWHD FLGLVQWRVT HRPVSIRNAA       240
     ERVLNFIGLG TSDLFQMVDP SKVYGDFKYE FPLPKRNDND HAMHICFLGE MPLGPDSLVV       300
     YRGKYHVGVR LDQVDLFRRE DGKLIRYVLY KNS                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page