(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE183

ASHGO_7.PE183        Location/Qualifiers
FT   CDS             345838..346545
FT                   /codon_start=1
FT                   /gene_family="HOG000260139" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20622486"
FT                   /locus_tag="AGL188W"
FT                   /product="Acyl-protein thioesterase 1 "
FT                   /EC_number="3.1.2.-"
FT                   /function="carboxylesterase activity"
FT                   /biological_process="fatty acid metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54303.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006631"
FT                   /db_xref="HOGENOM:HBG398734"
FT                   /db_xref="HOGENOM:HBG651281"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="UniParc:UPI00002533A6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750X7"
FT                   /transl_table=1
FT                   /translation="MSATAPIRIAARAQPAKYAFIIFHGLGDSGAGWTFLAEYLQRDPA
FT                   LASAQFVFPTAPVRPITANNFAPATAWLDVRSWLSHESVDLEGFNESMKLVPKLIEEQV
FT                   AQGIPYERIWIGGFSQGAALTMGTALSFPHRLGGFLSFSGPPSYRWLEHTVSDANTGAP
FT                   VFQSHGTMDEVFPSSGAEAVHRSFTSQYGFKNHRLKIYDGLGHSISPQLLDDALAFIKA
FT                   NLDAEKPAPRPAL"
     MSATAPIRIA ARAQPAKYAF IIFHGLGDSG AGWTFLAEYL QRDPALASAQ FVFPTAPVRP        60
     ITANNFAPAT AWLDVRSWLS HESVDLEGFN ESMKLVPKLI EEQVAQGIPY ERIWIGGFSQ       120
     GAALTMGTAL SFPHRLGGFL SFSGPPSYRW LEHTVSDANT GAPVFQSHGT MDEVFPSSGA       180
     EAVHRSFTSQ YGFKNHRLKI YDGLGHSISP QLLDDALAFI KANLDAEKPA PRPAL            235
//

If you have problems or comments...

PBIL Back to PBIL home page