(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE188

ASHGO_7.PE188        Location/Qualifiers
FT   CDS             complement(355256..356779)
FT                   /codon_start=1
FT                   /gene_family="HOG000197271" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750142"
FT                   /gene_name="BBP"
FT                   /locus_tag="AGL183C"
FT                   /product="Branchpoint-bridging protein "
FT                   /function="RNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="AAS54308.2"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG059785"
FT                   /db_xref="HSSP:1K1G"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI0001DB2B72"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750X2"
FT                   /transl_table=1
FT                   /translation="MTRLVWFCMQVAYCLHGWDWDIMDRGRSSNSYDSLWGGKARDNPI
FT                   VSQLPLQYRIRSALTQEQQTAYQVMYRIQEITIKLRTNDLNPPTSRYRSLSPPPVYDSQ
FT                   GKRTNTREHRYRKKLEEERHRLVEIALKMIPHFIAPDDYRRPSKFQDKYYIPINDYPEI
FT                   NFVGLLLGPRGNTLKQLQQQSGCKIVIRGRGSVKEGKAATDLPKGAMNMNEPLHCVISA
FT                   DTEEKIPLGINAVESIIIKAITSPEGQNDLKRGQLRELAVLNGTLREDNRPCPLCGEQG
FT                   HKKWECSSNPSLSMTVICQRCNQPGHAARDCTSPLNEFGKRTSDGPEFRETKKLQQDAP
FT                   PPSGPVGSHPSAPGSGSANSGVAPASLHPPGTMAPPGALPPPGSLAAPGTLPPPAALPA
FT                   PAAPGTLPPPVALPAPATLPQAGVPPAPDASPAVKTAVPIEGPPAPPQTAPPLRQTAAT
FT                   ASSAGSSQSAQEEPENARNGVEKAAPGPPAAVLPPPPPPPPPPPPPPSS"
     MTRLVWFCMQ VAYCLHGWDW DIMDRGRSSN SYDSLWGGKA RDNPIVSQLP LQYRIRSALT        60
     QEQQTAYQVM YRIQEITIKL RTNDLNPPTS RYRSLSPPPV YDSQGKRTNT REHRYRKKLE       120
     EERHRLVEIA LKMIPHFIAP DDYRRPSKFQ DKYYIPINDY PEINFVGLLL GPRGNTLKQL       180
     QQQSGCKIVI RGRGSVKEGK AATDLPKGAM NMNEPLHCVI SADTEEKIPL GINAVESIII       240
     KAITSPEGQN DLKRGQLREL AVLNGTLRED NRPCPLCGEQ GHKKWECSSN PSLSMTVICQ       300
     RCNQPGHAAR DCTSPLNEFG KRTSDGPEFR ETKKLQQDAP PPSGPVGSHP SAPGSGSANS       360
     GVAPASLHPP GTMAPPGALP PPGSLAAPGT LPPPAALPAP AAPGTLPPPV ALPAPATLPQ       420
     AGVPPAPDAS PAVKTAVPIE GPPAPPQTAP PLRQTAATAS SAGSSQSAQE EPENARNGVE       480
     KAAPGPPAAV LPPPPPPPPP PPPPPSS                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page