(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE19

ASHGO_7.PE19         Location/Qualifiers
FT   CDS             49847..51448
FT                   /codon_start=1
FT                   /gene_family="HOG000164982" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15749024"
FT                   /locus_tag="AGOS_AGL352W"
FT                   /product="AGL352Wp"
FT                   /function="catalytic activity"
FT                   /function="cation binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="AAS54139.2"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG056738"
FT                   /db_xref="InterPro:IPR004886"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI0001DB2AA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q751P1"
FT                   /transl_table=1
FT                   /translation="MLFNKLAAVAALGSLVTAATSSSGEVPEIVIKGNKFFYSNNGTQF
FT                   FMRGIAYQTDGHDGSGSNKYVDPLADFKTCSRDIPYLQQLRTNVIRVYALDGKKDHTEC
FT                   MKALADAGIYVIADLSEPSLSINRNSPEWSVELYDRYTQVVDELQKYKNVLGFFAGNEV
FT                   TNEVNNTEASAFVKAAVRDTKAYIKQKGYRKIPVGYAANDDAKFRDEITAYFACGSNEE
FT                   RADFYGFNVYSWCGDSSFEKSGYSDRTKEFSRLPVPAFFSEYGCNEVKPRKFTDVAALY
FT                   GDQMTDVWSGGIVYMYFQEANEYGLVTVKGDKVSTLSDFSYYSAQIAKASPTGVQSASY
FT                   TPSITSLECPTIADNWKAASSLPPTPSKDACKCMMDALSCVVNDSVDKEDYGKLFGYLC
FT                   GSDKKLCNGIAVDASKGEYGAFSYCSGKEKLSYLLNEYYKANGKSSSACAFSGSASLRK
FT                   PTEAATCAAVLSSASAGLPAGGNASGSSGAATSTGGSGEPKPSMGTANAKYNMLNVLIS
FT                   SAATLSVFMGFGLIFI"
     MLFNKLAAVA ALGSLVTAAT SSSGEVPEIV IKGNKFFYSN NGTQFFMRGI AYQTDGHDGS        60
     GSNKYVDPLA DFKTCSRDIP YLQQLRTNVI RVYALDGKKD HTECMKALAD AGIYVIADLS       120
     EPSLSINRNS PEWSVELYDR YTQVVDELQK YKNVLGFFAG NEVTNEVNNT EASAFVKAAV       180
     RDTKAYIKQK GYRKIPVGYA ANDDAKFRDE ITAYFACGSN EERADFYGFN VYSWCGDSSF       240
     EKSGYSDRTK EFSRLPVPAF FSEYGCNEVK PRKFTDVAAL YGDQMTDVWS GGIVYMYFQE       300
     ANEYGLVTVK GDKVSTLSDF SYYSAQIAKA SPTGVQSASY TPSITSLECP TIADNWKAAS       360
     SLPPTPSKDA CKCMMDALSC VVNDSVDKED YGKLFGYLCG SDKKLCNGIA VDASKGEYGA       420
     FSYCSGKEKL SYLLNEYYKA NGKSSSACAF SGSASLRKPT EAATCAAVLS SASAGLPAGG       480
     NASGSSGAAT STGGSGEPKP SMGTANAKYN MLNVLISSAA TLSVFMGFGL IFI              533
//

If you have problems or comments...

PBIL Back to PBIL home page