(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE194

ASHGO_7.PE194        Location/Qualifiers
FT   CDS             complement(368220..368708)
FT                   /codon_start=1
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18079278"
FT                   /locus_tag="AGL177C"
FT                   /orf_name="AGOS_AGL177C"
FT                   /product="AGL177Cp"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="AAS54314.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG524497"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="HSSP:1A58"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI00002533B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W6"
FT                   /transl_table=1
FT                   /translation="MSKVFFDVEADGQPLGRIVFQLYNDVTPKTAENFRALCTGEKGFG
FT                   YAGCPFHRVIPDFMLQGGDFTHGTGVGGKSIYGGKFPDENFVKKHEKPGLLSMANAGPN
FT                   TNGSQFFITTVPCPWLNGKHVVFGEVSEGMDVVKKVESMGSSSGATRARIVISKSGEL"
     MSKVFFDVEA DGQPLGRIVF QLYNDVTPKT AENFRALCTG EKGFGYAGCP FHRVIPDFML        60
     QGGDFTHGTG VGGKSIYGGK FPDENFVKKH EKPGLLSMAN AGPNTNGSQF FITTVPCPWL       120
     NGKHVVFGEV SEGMDVVKKV ESMGSSSGAT RARIVISKSG EL                          162
//

If you have problems or comments...

PBIL Back to PBIL home page