(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE196

ASHGO_7.PE196        Location/Qualifiers
FT   CDS             369511..370725
FT                   /codon_start=1
FT                   /gene_family="HOG000013358" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750147"
FT                   /locus_tag="AGL175W"
FT                   /orf_name="AGOS_AGL175W"
FT                   /product="AGL175Wp"
FT                   /function="NAD+ or NADH binding"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="aspartate-semialdehyde dehydrogenase activity "
FT                   /function="protein dimerization activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54316.1"
FT                   /db_xref="GO:0004073"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG000063"
FT                   /db_xref="HOGENOM:HBG518238"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00002533B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W4"
FT                   /transl_table=1
FT                   /translation="MQDESEAGGRALARRRGSCGGQKKSPSTISASSSRPEDKMAGKKI
FT                   AGVLGATGSVGQRFILLLADHPDFELKVLGASPRSAGKRYADAVNWKQTELMPAFAEDI
FT                   VVSECKAEAFCGCDVVFSGLDADYAGPIEREFADAGLAVVSNAKNHRREDDVPLVVPIA
FT                   NSEHLEMVQQKLESAAAEGRARPGFIVCISNCSTAGLVAPLKPLVDAFGPIDALSVTTM
FT                   QAISGAGFSPGVPGIDILDNVIPYIGGEEDKIEWEAKKILAPLNASKTSVELLSDEELR
FT                   VSAQCNRVAVSDGHTECVSLRFRNRPAPSVEAVKKCLREYVCEATHLGCHSAPKQAIHV
FT                   LEQQDRPQPRLDRLRDAGYGVSVGRVREDPVLDLKMVVLSHNTIIGAAGAGILIAELLL
FT                   AQQMI"
     MQDESEAGGR ALARRRGSCG GQKKSPSTIS ASSSRPEDKM AGKKIAGVLG ATGSVGQRFI        60
     LLLADHPDFE LKVLGASPRS AGKRYADAVN WKQTELMPAF AEDIVVSECK AEAFCGCDVV       120
     FSGLDADYAG PIEREFADAG LAVVSNAKNH RREDDVPLVV PIANSEHLEM VQQKLESAAA       180
     EGRARPGFIV CISNCSTAGL VAPLKPLVDA FGPIDALSVT TMQAISGAGF SPGVPGIDIL       240
     DNVIPYIGGE EDKIEWEAKK ILAPLNASKT SVELLSDEEL RVSAQCNRVA VSDGHTECVS       300
     LRFRNRPAPS VEAVKKCLRE YVCEATHLGC HSAPKQAIHV LEQQDRPQPR LDRLRDAGYG       360
     VSVGRVREDP VLDLKMVVLS HNTIIGAAGA GILIAELLLA QQMI                        404
//

If you have problems or comments...

PBIL Back to PBIL home page