(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE200

ASHGO_7.PE200        Location/Qualifiers
FT   CDS             379516..382071
FT                   /codon_start=1
FT                   /gene_family="HOG000065954" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750148"
FT                   /locus_tag="AGOS_AGL171W"
FT                   /product="AGL171Wp"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="AAS54320.2"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059795"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001DB2B75"
FT                   /db_xref="UniProtKB/TrEMBL:Q750W0"
FT                   /transl_table=1
FT                   /translation="MTGPRIGLFPEKNNYETTHGSSGLISTNNTDKDEEEDAWRTGESD
FT                   LHATGVESGSAAAERTSQVEMRILEDILMEDMVCGYEEFQERIKNDRFYLTKRYNTKVG
FT                   LNELNTDADARRDDIDFLTYSQKVASEYSFREKAEKLLKSINKQPIRVLTGEELHENYA
FT                   RGEEELVPVRPGTFGLRHFFKSSVKGRMLRQPTESDLVNTNGGISASTQVIDLEKNGQR
FT                   AIDESSNKSNIYESHRKELLPNGIHHPTSRGCLRNALIYLINNPLCESLRKPDRYHIQR
FT                   KLKVRHLQMIAIGASIGVGLFLTSGNAFAVAGPFGTLLGFSICGTVCLATMLSFTELST
FT                   LIPISSGFSGLASRFVEDAFGFALGWSYWLSFTVTFPSQIIASIFMLSYYEKVVATRIS
FT                   TAGLVTVFWLYATAVNLLDVRLFAEVNYISAFVKVLITILAMILMLFLNVRGVDGKSGA
FT                   IGFRFWNSSSSETELTYGLFRPTFDLHDTGQGSLNGIGGARGRFLAIILVVLISTYSFN
FT                   GVEMAFVASGEAINPRKTLPSATKRAFTKIVTLYILSITFVGLNMYSGDPRLLRYGVDV
FT                   PTVVYRNTPGLQWQRDYSCMEQDIMQLHNMENGNRSPWILALQSFGLCSLASAFNGVLV
FT                   FFGISAASSSLFASSRTLYSMATQQKAPKLFQTCTSYGVPWIAILFSGSFGIIAYISVA
FT                   ESSMANFQTLSSIASGTNAIIWLGLNVSFLRFYYALKRRPDIISRDDPTYPYRSPMQPF
FT                   LSFYGLIGSGLVVIFMGFTNFLHGFWSTRSFLSSYGGLIFFITSYFAYKLFGASKIQSL
FT                   EQLDMDTGRREMDRMIWDEHRQYSGSLWERFKYVITWLL"
     MTGPRIGLFP EKNNYETTHG SSGLISTNNT DKDEEEDAWR TGESDLHATG VESGSAAAER        60
     TSQVEMRILE DILMEDMVCG YEEFQERIKN DRFYLTKRYN TKVGLNELNT DADARRDDID       120
     FLTYSQKVAS EYSFREKAEK LLKSINKQPI RVLTGEELHE NYARGEEELV PVRPGTFGLR       180
     HFFKSSVKGR MLRQPTESDL VNTNGGISAS TQVIDLEKNG QRAIDESSNK SNIYESHRKE       240
     LLPNGIHHPT SRGCLRNALI YLINNPLCES LRKPDRYHIQ RKLKVRHLQM IAIGASIGVG       300
     LFLTSGNAFA VAGPFGTLLG FSICGTVCLA TMLSFTELST LIPISSGFSG LASRFVEDAF       360
     GFALGWSYWL SFTVTFPSQI IASIFMLSYY EKVVATRIST AGLVTVFWLY ATAVNLLDVR       420
     LFAEVNYISA FVKVLITILA MILMLFLNVR GVDGKSGAIG FRFWNSSSSE TELTYGLFRP       480
     TFDLHDTGQG SLNGIGGARG RFLAIILVVL ISTYSFNGVE MAFVASGEAI NPRKTLPSAT       540
     KRAFTKIVTL YILSITFVGL NMYSGDPRLL RYGVDVPTVV YRNTPGLQWQ RDYSCMEQDI       600
     MQLHNMENGN RSPWILALQS FGLCSLASAF NGVLVFFGIS AASSSLFASS RTLYSMATQQ       660
     KAPKLFQTCT SYGVPWIAIL FSGSFGIIAY ISVAESSMAN FQTLSSIASG TNAIIWLGLN       720
     VSFLRFYYAL KRRPDIISRD DPTYPYRSPM QPFLSFYGLI GSGLVVIFMG FTNFLHGFWS       780
     TRSFLSSYGG LIFFITSYFA YKLFGASKIQ SLEQLDMDTG RREMDRMIWD EHRQYSGSLW       840
     ERFKYVITWL L                                                            851
//

If you have problems or comments...

PBIL Back to PBIL home page