(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE21

ASHGO_7.PE21         Location/Qualifiers
FT   CDS             complement(53849..54856)
FT                   /codon_start=1
FT                   /gene_family="HOG000048630" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI18927759"
FT                   /gene_name="PXR1"
FT                   /locus_tag="AGL350C"
FT                   /product="Protein PXR1"
FT                   /function="nucleic acid binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="AAS54141.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG190448"
FT                   /db_xref="HOGENOM:HBG396989"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI0000253306"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q751P0"
FT                   /transl_table=1
FT                   /translation="MGLAATKTKQRFGLDPRNTTWSNDKSRFGHKYLEKLGWEPGKGLG
FT                   HASHAMSTHIKVTIKDDTMGLGAKLKKKEKKDEFDSGECAGLDVFQRILGRLNGKEEVI
FT                   ADELEKQRKENIINGKWGIHFVKGEVLSSTWDADTMQLKSYSYDKKEITADDAEDAKVS
FT                   GKHRDRKSRAKREKSNNAALKEKCRDIDRTRKSKRKEKEQEKEKNREKKHNGKEHKEKE
FT                   HKEKKDKKDKKEKKEKKEKKEKKEKKHKEKSNKRLRSSDSIDDPEATKPSKKSKTKAAD
FT                   SDNVTRDSMLQPRASAASPPPTISTRLSVRSKWIRQKRAAVMDPKALNEIFMVT"
     MGLAATKTKQ RFGLDPRNTT WSNDKSRFGH KYLEKLGWEP GKGLGHASHA MSTHIKVTIK        60
     DDTMGLGAKL KKKEKKDEFD SGECAGLDVF QRILGRLNGK EEVIADELEK QRKENIINGK       120
     WGIHFVKGEV LSSTWDADTM QLKSYSYDKK EITADDAEDA KVSGKHRDRK SRAKREKSNN       180
     AALKEKCRDI DRTRKSKRKE KEQEKEKNRE KKHNGKEHKE KEHKEKKDKK DKKEKKEKKE       240
     KKEKKEKKHK EKSNKRLRSS DSIDDPEATK PSKKSKTKAA DSDNVTRDSM LQPRASAASP       300
     PPTISTRLSV RSKWIRQKRA AVMDPKALNE IFMVT                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page