(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE225

ASHGO_7.PE225        Location/Qualifiers
FT   CDS             complement(423010..428700)
FT                   /codon_start=1
FT                   /gene_family="HOG000181045" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18928051"
FT                   /locus_tag="AGOS_AGL147C"
FT                   /product="AGL147Cp"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /function="binding"
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="AAS54344.2"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG059810"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR015403"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001DB2B91"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T6"
FT                   /transl_table=1
FT                   /translation="MASSVDRVNEVSPPESVQKENMSNNSTEDVAEHVQVGKEVISGTN
FT                   ANGVAQKKTFDEPVIEISTPASVQKENMSSNSVEDVAQHVQMGADAIPDTSANSSDQNN
FT                   ALGESTKVEQTSEDGDERFVKGPVEATGNSTAPSPPTSQDNLKRHTRAYSNVSGSPWTM
FT                   KSAVHLVKTTLEGILQAKSMHKHPNNEKLVEKTVKNLTEQLLQSENDPKFLDSLLVFEA
FT                   LRACCRTNVPEIQVSALDCLSKLFAFKALDENVLVNPPNSAASNDQGTTLPDSGVTPPP
FT                   RMRLIDAAVDTITDCFDGEATDGKVELQVVRALASCILTDEPYCNCHGASLLKAVRQIY
FT                   NIFILSLSSSNQGIAQATLTQIVNATFEKINVVSLYPPSFSQNSLRKEPLEHYSPTSVE
FT                   DQPPLTLQNLESFNEEHEGQLDSMDTEHDASTTDEQSLIVKDAFLVFRVMSKLSVKPLD
FT                   DNLDMRSYAVRSKLLALHIIHSIMRDHIDVFLSHNVLLPGKQNTTLLNGVKQYLCLALA
FT                   RNAASPIAPVFEITFEIMWLLVSNLRSEFKREIPVFLTEIYFPISHMKSSTPHQKRYFL
FT                   SVIQRLCNDPRTLIEFYLNYDCDSSMPNIVETVVDYLTRLALTRVDITASQRAYYDEQV
FT                   NKPLATYNLSQLPLLSISNVSSMSVAPQQLQFPVEFALKMTSLKCMLAVLRSLNSWADK
FT                   ATAPNGTLNHNRASVGSSTIERKHSSAFSSFSHTMNTTPVGDQNSVQQSEASEDIDDPT
FT                   QFENLKLRKTELQKCIRLFNFKPHKGIQDLLKLGFIKDTTPNAIAKWLLYTPGLDLAAV
FT                   GDYLGEGSEENIAIMHAFVDELDFSNLSLVDALRVFLQRFRLPGEGQKIDRFMLKFAER
FT                   YVDQNPDRFATLTAYTLSYSIILLNTDLHSSQIKNKMTLDEFVDNNRGIDNGKDLPREL
FT                   LAQLFNEIAQNEIKLQSEQHQAMIAGDLNPVHQQSAFAFFSGKDLEREAYMQLSKEISS
FT                   KTELVFKNWEKAKSGDKVFYAASHVEHVRSIFETLWMSFLAALTPPFKEYDDLETTMMC
FT                   LEGLKMSIKISTRFGIDYARASFIGALIQFANLQNIQEIQPKNVNAIIALLEVALSEGN
FT                   FFRDSWRDVLVIASQVERLQLISKGVDGESVPDVAQARLANHRSSFDSTRSMSMSFFER
FT                   WTKKSNPIEIAQEKHHNQSLSPEIYDYISSSKLVVLIDRIFTNSSKLSGQGIMDFIKAL
FT                   IQVSREEIESSQDAATPRMFSLQKMVDVCYYNMDRIRVEWTPIWAVLGEAFNWTATSPN
FT                   LAVVFFAIDSLRQLSIRFLDIEELPGFEFQHDFLKPFQHIIQNTTNTDVQEMCMECFRN
FT                   FILVKSTTLKSGWKPILESLQFCARSSKESIVLKTYQLITVDVMKDHFESVFVQEDAFI
FT                   ELVGVLREITKNRKYQKLSLHSLKSLKKIYQKVAELCFKKENQHLLHGKDIFEDIWYPV
FT                   LYSFNDAVMTADDLEVRSRALNFMFDALVEYGGEFGISFWESVCTRLLFPIFGVLSKHW
FT                   EVNQFNSHDDLSVWLSTTLIQALRNMVALFTHYFDSLNEMLDGFLVLLVSCICQENDTI
FT                   ARIGRSCLQQLIIQNTNKFGTTHWEQVTNSFARLFELTTATELFESDPLKRGRKPSVAT
FT                   INTNGTAETQSCASDVDREVERAQREEKGEDVGNASTEEDKPMSRLVRTKSSEEIGHRV
FT                   SIKNTIVVKCVLQLLMIESLSELFADENFANAIPFKNAIRLTSLLESSYWFARDFNDDF
FT                   ELRNRLVNARIVDKIPNLMKQETSSSAVLIDILFKIYLNDETPDSETSADLLARLVGIC
FT                   TQIVVRYVALDEATMERTIATWRPVIVEILLGYHELDDDDFRSQSPAMYKLVLQVLDKA
FT                   CPLDLRHAIKVFLSRVGDLYLV"
     MASSVDRVNE VSPPESVQKE NMSNNSTEDV AEHVQVGKEV ISGTNANGVA QKKTFDEPVI        60
     EISTPASVQK ENMSSNSVED VAQHVQMGAD AIPDTSANSS DQNNALGEST KVEQTSEDGD       120
     ERFVKGPVEA TGNSTAPSPP TSQDNLKRHT RAYSNVSGSP WTMKSAVHLV KTTLEGILQA       180
     KSMHKHPNNE KLVEKTVKNL TEQLLQSEND PKFLDSLLVF EALRACCRTN VPEIQVSALD       240
     CLSKLFAFKA LDENVLVNPP NSAASNDQGT TLPDSGVTPP PRMRLIDAAV DTITDCFDGE       300
     ATDGKVELQV VRALASCILT DEPYCNCHGA SLLKAVRQIY NIFILSLSSS NQGIAQATLT       360
     QIVNATFEKI NVVSLYPPSF SQNSLRKEPL EHYSPTSVED QPPLTLQNLE SFNEEHEGQL       420
     DSMDTEHDAS TTDEQSLIVK DAFLVFRVMS KLSVKPLDDN LDMRSYAVRS KLLALHIIHS       480
     IMRDHIDVFL SHNVLLPGKQ NTTLLNGVKQ YLCLALARNA ASPIAPVFEI TFEIMWLLVS       540
     NLRSEFKREI PVFLTEIYFP ISHMKSSTPH QKRYFLSVIQ RLCNDPRTLI EFYLNYDCDS       600
     SMPNIVETVV DYLTRLALTR VDITASQRAY YDEQVNKPLA TYNLSQLPLL SISNVSSMSV       660
     APQQLQFPVE FALKMTSLKC MLAVLRSLNS WADKATAPNG TLNHNRASVG SSTIERKHSS       720
     AFSSFSHTMN TTPVGDQNSV QQSEASEDID DPTQFENLKL RKTELQKCIR LFNFKPHKGI       780
     QDLLKLGFIK DTTPNAIAKW LLYTPGLDLA AVGDYLGEGS EENIAIMHAF VDELDFSNLS       840
     LVDALRVFLQ RFRLPGEGQK IDRFMLKFAE RYVDQNPDRF ATLTAYTLSY SIILLNTDLH       900
     SSQIKNKMTL DEFVDNNRGI DNGKDLPREL LAQLFNEIAQ NEIKLQSEQH QAMIAGDLNP       960
     VHQQSAFAFF SGKDLEREAY MQLSKEISSK TELVFKNWEK AKSGDKVFYA ASHVEHVRSI      1020
     FETLWMSFLA ALTPPFKEYD DLETTMMCLE GLKMSIKIST RFGIDYARAS FIGALIQFAN      1080
     LQNIQEIQPK NVNAIIALLE VALSEGNFFR DSWRDVLVIA SQVERLQLIS KGVDGESVPD      1140
     VAQARLANHR SSFDSTRSMS MSFFERWTKK SNPIEIAQEK HHNQSLSPEI YDYISSSKLV      1200
     VLIDRIFTNS SKLSGQGIMD FIKALIQVSR EEIESSQDAA TPRMFSLQKM VDVCYYNMDR      1260
     IRVEWTPIWA VLGEAFNWTA TSPNLAVVFF AIDSLRQLSI RFLDIEELPG FEFQHDFLKP      1320
     FQHIIQNTTN TDVQEMCMEC FRNFILVKST TLKSGWKPIL ESLQFCARSS KESIVLKTYQ      1380
     LITVDVMKDH FESVFVQEDA FIELVGVLRE ITKNRKYQKL SLHSLKSLKK IYQKVAELCF      1440
     KKENQHLLHG KDIFEDIWYP VLYSFNDAVM TADDLEVRSR ALNFMFDALV EYGGEFGISF      1500
     WESVCTRLLF PIFGVLSKHW EVNQFNSHDD LSVWLSTTLI QALRNMVALF THYFDSLNEM      1560
     LDGFLVLLVS CICQENDTIA RIGRSCLQQL IIQNTNKFGT THWEQVTNSF ARLFELTTAT      1620
     ELFESDPLKR GRKPSVATIN TNGTAETQSC ASDVDREVER AQREEKGEDV GNASTEEDKP      1680
     MSRLVRTKSS EEIGHRVSIK NTIVVKCVLQ LLMIESLSEL FADENFANAI PFKNAIRLTS      1740
     LLESSYWFAR DFNDDFELRN RLVNARIVDK IPNLMKQETS SSAVLIDILF KIYLNDETPD      1800
     SETSADLLAR LVGICTQIVV RYVALDEATM ERTIATWRPV IVEILLGYHE LDDDDFRSQS      1860
     PAMYKLVLQV LDKACPLDLR HAIKVFLSRV GDLYLV                                1896
//

If you have problems or comments...

PBIL Back to PBIL home page