(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE228

ASHGO_7.PE228        Location/Qualifiers
FT   CDS             complement(432968..433987)
FT                   /codon_start=1
FT                   /gene_family="HOG000065947" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750156"
FT                   /locus_tag="AGOS_AGL144C"
FT                   /product="AGL144Cp"
FT                   /function="inositol trisphosphate 3-kinase activity "
FT                   /protein_id="AAS54347.2"
FT                   /db_xref="GO:0008440"
FT                   /db_xref="HOGENOM:HBG059811"
FT                   /db_xref="InterPro:IPR005522"
FT                   /db_xref="UniParc:UPI0001DB2BA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q750T3"
FT                   /transl_table=1
FT                   /translation="MGHKKLRHQAAGHDGTLTDIDERLIFKPAVDQELEFYTGIISRKD
FT                   REGVDFPLECWMCVFVGTLSEGILNVENNDSIMRLKGEDVVKPTTDYLQHLNLSNDHTQ
FT                   KYLVLENLTYGYRRPNILDIKLGKVLYDDKATEEKKARLTTISASTTSGSLGFRVCGMK
FT                   IERNSLIGQLDKSHYEEDDDDYVLLNKLYGRSRTVDNVSDAFRLFFNAPNLPKHRHAEL
FT                   INRFAVRLRMFYNTLLDEEVRMISSSLLFVYEGDPERWDMENAVDGVLNEPCFLDGDSD
FT                   CSSEEWDKSRNIPLSSMTLIDFAHSKFTPGEGYDENVIVGVENLMEVFDKVSGEYGEQ"
     MGHKKLRHQA AGHDGTLTDI DERLIFKPAV DQELEFYTGI ISRKDREGVD FPLECWMCVF        60
     VGTLSEGILN VENNDSIMRL KGEDVVKPTT DYLQHLNLSN DHTQKYLVLE NLTYGYRRPN       120
     ILDIKLGKVL YDDKATEEKK ARLTTISAST TSGSLGFRVC GMKIERNSLI GQLDKSHYEE       180
     DDDDYVLLNK LYGRSRTVDN VSDAFRLFFN APNLPKHRHA ELINRFAVRL RMFYNTLLDE       240
     EVRMISSSLL FVYEGDPERW DMENAVDGVL NEPCFLDGDS DCSSEEWDKS RNIPLSSMTL       300
     IDFAHSKFTP GEGYDENVIV GVENLMEVFD KVSGEYGEQ                              339
//

If you have problems or comments...

PBIL Back to PBIL home page