(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE239

ASHGO_7.PE239        Location/Qualifiers
FT   CDS             773041..777480
FT                   /codon_start=1
FT                   /gene_family="HOG000154264" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750162"
FT                   /gene_name="SCC2"
FT                   /locus_tag="AGL133W"
FT                   /product="Sister chromatid cohesion protein 2 "
FT                   /function="binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="nucleus"
FT                   /protein_id="AAS54358.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG059817"
FT                   /db_xref="HOGENOM:HBG203190"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00002533DD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750S2"
FT                   /transl_table=1
FT                   /translation="MSTFPGEDTRIPKRISEALSHQPLNHLVPKRELSRLLSKPVQISV
FT                   QLESEDAFEEVPEELWQYPHPIDLDPLRLEESQPLRFRRPRGARLDYREDSSEIADLPG
FT                   MGQLARACLSGTQLVDSAAIVESIESNAKKRKQTLAIGDVEMVSPDKKTKVMASVSPVS
FT                   LNRVALGSQHLKTLERLMQYIGADESSAEFGDFEYWITLEDRATHILSEQCIDKLHIVF
FT                   RNILSIPAVWTELDVSLLQRIMDVCVSTITICLEKIELKEYSHDYTLIAFGSSMVVFFI
FT                   FLLDQNDRRLQLEQYMMVPLQFLTFTADNLEEEFDRGGNGVERSLAMLHSTLDVFYMYI
FT                   SNKPKLDDGLVVKLVYMFTELIMSTWSHNVSSVSLQNHIGNVKTIGMKSIEVLFEKLPE
FT                   QRLFIIDELLSHLDNLPNTRSQKRMKNIGKNLHITHFSYIMLSILQVWNNYDYCSNLVS
FT                   PDTEQLHDLIAHHAATQSDLEFAADHIIDTILKKCFSNISKYRFVFDQFVTDMTTVVTL
FT                   PDWPVSDLILARLLKKLLSIFNPQSQKHINIESVALQGIGLIGSTILDIRLSSNSNPTA
FT                   NLIHLFNYPEDIDGLFKAYRTCLAYCTNSVQHHTPYKFLWCKQLDVLTKLKEMDKESQG
FT                   WGSKLQQKFLSLIESIHLPLEQAANLGAVEILPTYCSTLLTSELINMYEPYLKLVLSLL
FT                   ERHKVKLRSGAIRCLALLISKDKNMLYTPIVKETIENRLTDSSPLVKDAILELIELGSS
FT                   YIDFYQHININYNDDSMLVRKHVLRMNQIIYDDTEDIIIKAYVASRILRRIEDEEDVII
FT                   ETARSELLKRWILSIQCPNAKPELQIKNCRVSIRVIAQLLVGGDKICDLFEHFLIFYVL
FT                   NKNAHTEDQNKLISSSLCLLTDQVIEMVIENEAADVDNQREEEGRNIMKFLSVLSSCQD
FT                   SFITKDHITALYPYLHSDTKSDFQLHILKVYRNTFEQLSHFKPKFLYDLETTILSRLPR
FT                   MNVRELDEAIPLSWSLSRHRKDDTRICKACASCLGQLSPYIANATTDPSAVRPDGKLQR
FT                   LLYLATGFARFCSFENTEGKFPNLKTRENIFEYVTKCLLMFTKENIHHVIRRIATKNLV
FT                   KIASRYPKLFNSRHVLTVLDTQFEKGILDIQLVVLESLYDFFLAEERRSLIQVGVDGTI
FT                   SSNNELRKVVANHTKSDSINDGICSALVSRYLDKILKICLIADLNNAMVAIRFLKQILT
FT                   YGYTNPSLCVPTVIALTASPNSYMRDLSSEMFSELLQGYESMAFNCLNQGIRLGTEYAV
FT                   KIRPKQFHEDSMFLRRLQQLMSTNKRNRSKFLKVVKKTVFSNYLSTSVNYEESCYHIIY
FT                   LLHNLSKISYDNMLELYEMLRSVISVSEYFSDRISERLDGFQSNQNTAAEVSAIIVTRL
FT                   SIEEFKRFMFEQHHLSEAKLTLLDATDDENLRNKSVAALDDQVGSLHMENIFLGYENPI
FT                   NNKDYCWKYISTLHRDEI"
     MSTFPGEDTR IPKRISEALS HQPLNHLVPK RELSRLLSKP VQISVQLESE DAFEEVPEEL        60
     WQYPHPIDLD PLRLEESQPL RFRRPRGARL DYREDSSEIA DLPGMGQLAR ACLSGTQLVD       120
     SAAIVESIES NAKKRKQTLA IGDVEMVSPD KKTKVMASVS PVSLNRVALG SQHLKTLERL       180
     MQYIGADESS AEFGDFEYWI TLEDRATHIL SEQCIDKLHI VFRNILSIPA VWTELDVSLL       240
     QRIMDVCVST ITICLEKIEL KEYSHDYTLI AFGSSMVVFF IFLLDQNDRR LQLEQYMMVP       300
     LQFLTFTADN LEEEFDRGGN GVERSLAMLH STLDVFYMYI SNKPKLDDGL VVKLVYMFTE       360
     LIMSTWSHNV SSVSLQNHIG NVKTIGMKSI EVLFEKLPEQ RLFIIDELLS HLDNLPNTRS       420
     QKRMKNIGKN LHITHFSYIM LSILQVWNNY DYCSNLVSPD TEQLHDLIAH HAATQSDLEF       480
     AADHIIDTIL KKCFSNISKY RFVFDQFVTD MTTVVTLPDW PVSDLILARL LKKLLSIFNP       540
     QSQKHINIES VALQGIGLIG STILDIRLSS NSNPTANLIH LFNYPEDIDG LFKAYRTCLA       600
     YCTNSVQHHT PYKFLWCKQL DVLTKLKEMD KESQGWGSKL QQKFLSLIES IHLPLEQAAN       660
     LGAVEILPTY CSTLLTSELI NMYEPYLKLV LSLLERHKVK LRSGAIRCLA LLISKDKNML       720
     YTPIVKETIE NRLTDSSPLV KDAILELIEL GSSYIDFYQH ININYNDDSM LVRKHVLRMN       780
     QIIYDDTEDI IIKAYVASRI LRRIEDEEDV IIETARSELL KRWILSIQCP NAKPELQIKN       840
     CRVSIRVIAQ LLVGGDKICD LFEHFLIFYV LNKNAHTEDQ NKLISSSLCL LTDQVIEMVI       900
     ENEAADVDNQ REEEGRNIMK FLSVLSSCQD SFITKDHITA LYPYLHSDTK SDFQLHILKV       960
     YRNTFEQLSH FKPKFLYDLE TTILSRLPRM NVRELDEAIP LSWSLSRHRK DDTRICKACA      1020
     SCLGQLSPYI ANATTDPSAV RPDGKLQRLL YLATGFARFC SFENTEGKFP NLKTRENIFE      1080
     YVTKCLLMFT KENIHHVIRR IATKNLVKIA SRYPKLFNSR HVLTVLDTQF EKGILDIQLV      1140
     VLESLYDFFL AEERRSLIQV GVDGTISSNN ELRKVVANHT KSDSINDGIC SALVSRYLDK      1200
     ILKICLIADL NNAMVAIRFL KQILTYGYTN PSLCVPTVIA LTASPNSYMR DLSSEMFSEL      1260
     LQGYESMAFN CLNQGIRLGT EYAVKIRPKQ FHEDSMFLRR LQQLMSTNKR NRSKFLKVVK      1320
     KTVFSNYLST SVNYEESCYH IIYLLHNLSK ISYDNMLELY EMLRSVISVS EYFSDRISER      1380
     LDGFQSNQNT AAEVSAIIVT RLSIEEFKRF MFEQHHLSEA KLTLLDATDD ENLRNKSVAA      1440
     LDDQVGSLHM ENIFLGYENP INNKDYCWKY ISTLHRDEI                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page