(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE24

ASHGO_7.PE24         Location/Qualifiers
FT   CDS             complement(61187..63076)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18927760"
FT                   /locus_tag="AGL347C"
FT                   /orf_name="AGOS_AGL347C"
FT                   /product="AGL347Cp"
FT                   /function="catalytic activity"
FT                   /protein_id="AAS54144.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG059819"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI0000253309"
FT                   /db_xref="UniProtKB/TrEMBL:Q751N7"
FT                   /transl_table=1
FT                   /translation="MDGGCADGGQVKRAGRPASVGRQIAMASGTSGHVLAVSALPLDRP
FT                   VFCAEDEGVLEVVRRLQAEGGHCALVGDGGRVAGIITTKDLALRGRGSARERRVRDVVT
FT                   WGAVTVDEHAPVNAALELMVVRRLRHLPVLQAGSREVLGVLDITKCFQLAMAWLEWAAV
FT                   GGTRLQDVLSDVACGAADGRRRALGIARVVQQMEMPTLQWLLASRRYATGLAVASPTTT
FT                   VREALALMRRLDTTAVLVRDVEPLAAGAQGLPSPHVRPGRGADAYTVIGIFTSKDVVCR
FT                   VLQQGLDPETDGCTLARFMTSWPQYAAETEGLHSALLMMHDGHYLNLPVVKTTGAIVGL
FT                   FTVLQLTHAALSWCLEGRLQGDSLHVGGASCAVKKETGDPGAHGRLTRADQWYNLVGEH
FT                   DYIYFLQSFDTSDYACSISSSSSQSPTKMQQSCLVSHRQLDTISNPELEFTNVRLSPQH
FT                   TRFRRPGFCKRQRTLLQKDFFGNCASGTHTCRVAVVLADGDGSNFINSVRVLVRGNGLD
FT                   SFRRLIVKIDATLKLGSAIGDSDMYHINCPDKLIKCEQDFQDILKLHFKTAGYGSDIPL
FT                   ILKLKRYSKPGWGLSLLNWLISRFQALRSVAESSWMKFGVFFMLGVGFGKMLL"
     MDGGCADGGQ VKRAGRPASV GRQIAMASGT SGHVLAVSAL PLDRPVFCAE DEGVLEVVRR        60
     LQAEGGHCAL VGDGGRVAGI ITTKDLALRG RGSARERRVR DVVTWGAVTV DEHAPVNAAL       120
     ELMVVRRLRH LPVLQAGSRE VLGVLDITKC FQLAMAWLEW AAVGGTRLQD VLSDVACGAA       180
     DGRRRALGIA RVVQQMEMPT LQWLLASRRY ATGLAVASPT TTVREALALM RRLDTTAVLV       240
     RDVEPLAAGA QGLPSPHVRP GRGADAYTVI GIFTSKDVVC RVLQQGLDPE TDGCTLARFM       300
     TSWPQYAAET EGLHSALLMM HDGHYLNLPV VKTTGAIVGL FTVLQLTHAA LSWCLEGRLQ       360
     GDSLHVGGAS CAVKKETGDP GAHGRLTRAD QWYNLVGEHD YIYFLQSFDT SDYACSISSS       420
     SSQSPTKMQQ SCLVSHRQLD TISNPELEFT NVRLSPQHTR FRRPGFCKRQ RTLLQKDFFG       480
     NCASGTHTCR VAVVLADGDG SNFINSVRVL VRGNGLDSFR RLIVKIDATL KLGSAIGDSD       540
     MYHINCPDKL IKCEQDFQDI LKLHFKTAGY GSDIPLILKL KRYSKPGWGL SLLNWLISRF       600
     QALRSVAESS WMKFGVFFML GVGFGKMLL                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page