(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE254

ASHGO_7.PE254        Location/Qualifiers
FT   CDS             799134..800378
FT                   /codon_start=1
FT                   /gene_family="HOG000111204" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI18079296"
FT                   /locus_tag="AGL118W"
FT                   /orf_name="AGOS_AGL118W"
FT                   /product="AGL118Wp"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="AAS54373.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG059825"
FT                   /db_xref="HOGENOM:HBG203195"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI00002533EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q750R0"
FT                   /transl_table=1
FT                   /translation="MSATRHAAGQPRVQQAAEVCGTCGMTEATGGIGVKRYRSPMKVKL
FT                   PITPPSSVKKKQTEACDSGPSVSEEVTPKELLPALRKARAPVRRKPRLTYRPATNSVFQ
FT                   LAHYVSDPELVSARDADFIRYALQHSRDIVVVTGAGISVAAGIPDFRSSDGLFATLRGG
FT                   KVKSGKHLFDFNHVYSSDDMSMQFNRMIVDIHGKSQRFEPTEFHRLLDGLAQQGRVRRI
FT                   YTQNIDCLENKLANISSLQTGPKQVPKTIQLHGSINHMCCNKCRKIYDMDPTLFKCGDN
FT                   DTTGDVIPVCPECEELEAVRRIAGKREQGVGKLRPYIVLYNEVHPEGEKVGEIVAKDLR
FT                   LKCDCLIIVGTSLQIPGVKTICRQFCQAVRARKGIVLWVNKELPTQAIQDFLGGMDLII
FT                   VGDCQDLTTLAPSFN"
     MSATRHAAGQ PRVQQAAEVC GTCGMTEATG GIGVKRYRSP MKVKLPITPP SSVKKKQTEA        60
     CDSGPSVSEE VTPKELLPAL RKARAPVRRK PRLTYRPATN SVFQLAHYVS DPELVSARDA       120
     DFIRYALQHS RDIVVVTGAG ISVAAGIPDF RSSDGLFATL RGGKVKSGKH LFDFNHVYSS       180
     DDMSMQFNRM IVDIHGKSQR FEPTEFHRLL DGLAQQGRVR RIYTQNIDCL ENKLANISSL       240
     QTGPKQVPKT IQLHGSINHM CCNKCRKIYD MDPTLFKCGD NDTTGDVIPV CPECEELEAV       300
     RRIAGKREQG VGKLRPYIVL YNEVHPEGEK VGEIVAKDLR LKCDCLIIVG TSLQIPGVKT       360
     ICRQFCQAVR ARKGIVLWVN KELPTQAIQD FLGGMDLIIV GDCQDLTTLA PSFN             414
//

If you have problems or comments...

PBIL Back to PBIL home page