(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE262

ASHGO_7.PE262        Location/Qualifiers
FT   CDS             complement(813439..814272)
FT                   /codon_start=1
FT                   /gene_family="HOG000020768" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15750176"
FT                   /locus_tag="AGL110C"
FT                   /orf_name="AGOS_AGL110C"
FT                   /product="AGL110Cp"
FT                   /function="ATP binding"
FT                   /function="dephospho-CoA kinase activity"
FT                   /biological_process="coenzyme A biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54381.1"
FT                   /db_xref="GO:0004140"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015937"
FT                   /db_xref="HOGENOM:HBG460048"
FT                   /db_xref="HOGENOM:HBG650290"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="UniParc:UPI00002533F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q750Q2"
FT                   /transl_table=1
FT                   /translation="MLVIGLTGGIACGKSTVSRRLHERYRIPVIDADAIAREIMRPGER
FT                   AYQRVVERFEQRVPQLVQANGELNRAALGAWIFQHAEERQALNAITHPEIRKRIFFRVV
FT                   DCYMRMHPMCVLDIPLLFETGLDVFCGVTVSVVCDQKVQIERLLLRNAELTREEAEARI
FT                   RAQMSMEERIELSDYVIPNNDNYEVLFETVDQAVTYIKPYLLTVMLHYFLPFGIVSALA
FT                   VVLSKYYKKTVAGTSRRKRRKAKERAAKKRAAEQKAALKASQPPLYKRLLSRKAE"
     MLVIGLTGGI ACGKSTVSRR LHERYRIPVI DADAIAREIM RPGERAYQRV VERFEQRVPQ        60
     LVQANGELNR AALGAWIFQH AEERQALNAI THPEIRKRIF FRVVDCYMRM HPMCVLDIPL       120
     LFETGLDVFC GVTVSVVCDQ KVQIERLLLR NAELTREEAE ARIRAQMSME ERIELSDYVI       180
     PNNDNYEVLF ETVDQAVTYI KPYLLTVMLH YFLPFGIVSA LAVVLSKYYK KTVAGTSRRK       240
     RRKAKERAAK KRAAEQKAAL KASQPPLYKR LLSRKAE                                277
//

If you have problems or comments...

PBIL Back to PBIL home page