(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE265

ASHGO_7.PE265        Location/Qualifiers
FT   CDS             817185..818213
FT                   /codon_start=1
FT                   /gene_family="HOG000248573" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI15750178"
FT                   /locus_tag="AGL107W"
FT                   /orf_name="AGOS_AGL107W"
FT                   /product="AGL107Wp"
FT                   /function="octanoyltransferase activity"
FT                   /biological_process="lipoate biosynthetic process "
FT                   /biological_process="protein modification process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="AAS54384.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0009107"
FT                   /db_xref="GO:0016415"
FT                   /db_xref="HOGENOM:HBG059832"
FT                   /db_xref="HOGENOM:HBG395385"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniParc:UPI00002533F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q750P9"
FT                   /transl_table=1
FT                   /translation="MLRYAMTPRRSIWTPLQVNQGVMVRMVMHRPILGHLSRMRYSSTS
FT                   PKDAQAITYPVTEKARVLEHIHFKKRCTFKEGLQIQELYVMHALEAKRMQSKIAQRLRQ
FT                   RAETATNTDLLLDWPAPAKCISTPRPTVLTFEFEPTYTGGKRIKKTITKDEVQALESFT
FT                   PPGSEGYPSPKFVQVERGGQVTFHGPGQMVAYIVLDLKAFHGFTVRCLVSAIERATINT
FT                   LQCAPKHEASRNATRRRNDKLGIKAIQTSENGVWIDEKRKIASLGVNVRRSITSHGVCI
FT                   NVNPTLQYLNHFTMCGLPESSATSIHELVPSATCGVGDIAATFVNQFRMLLGIEEIVRS
FT                   DI"
     MLRYAMTPRR SIWTPLQVNQ GVMVRMVMHR PILGHLSRMR YSSTSPKDAQ AITYPVTEKA        60
     RVLEHIHFKK RCTFKEGLQI QELYVMHALE AKRMQSKIAQ RLRQRAETAT NTDLLLDWPA       120
     PAKCISTPRP TVLTFEFEPT YTGGKRIKKT ITKDEVQALE SFTPPGSEGY PSPKFVQVER       180
     GGQVTFHGPG QMVAYIVLDL KAFHGFTVRC LVSAIERATI NTLQCAPKHE ASRNATRRRN       240
     DKLGIKAIQT SENGVWIDEK RKIASLGVNV RRSITSHGVC INVNPTLQYL NHFTMCGLPE       300
     SSATSIHELV PSATCGVGDI AATFVNQFRM LLGIEEIVRS DI                          342
//

If you have problems or comments...

PBIL Back to PBIL home page