(data stored in ACNUC7421 zone)

HOGENOMDNA: ASHGO_7.PE267

ASHGO_7.PE267        Location/Qualifiers
FT   CDS             820160..820606
FT                   /codon_start=1
FT                   /gene_family="HOG000154374" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI19775041"
FT                   /gene_name="SPC19"
FT                   /locus_tag="AGL105W"
FT                   /product="DASH complex subunit SPC19 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle"
FT                   /protein_id="AAS54386.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005819"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG192650"
FT                   /db_xref="HOGENOM:HBG203202"
FT                   /db_xref="InterPro:IPR013251"
FT                   /db_xref="UniParc:UPI00002533F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q750P7"
FT                   /transl_table=1
FT                   /translation="MDISLDESCVALESSVKLLGKTLERLAEQGEHSRRLTSTLLRSKR
FT                   VFELVSEYDLQRARLDVIEEVEPVVEKLCSKLEKSLNKLERERATLQQTYELNQLRLNN
FT                   RLAGSGGRRPVVMGTSTTEELGRLREAKQRKAALEREIAEVRGT"
     MDISLDESCV ALESSVKLLG KTLERLAEQG EHSRRLTSTL LRSKRVFELV SEYDLQRARL        60
     DVIEEVEPVV EKLCSKLEKS LNKLERERAT LQQTYELNQL RLNNRLAGSG GRRPVVMGTS       120
     TTEELGRLRE AKQRKAALER EIAEVRGT                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page